Set cath from cathlist by auto on 05 Mar 2006 19:22
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1n2zA01 | 22 | 140 |
| 1n2zA02 | 141 | 266 |
There are 13 matching structural neighberhood comparisons for CATH ID 3.40.50.1980.16.1.1.1.1 (SIMAX score < 5)
>pdb|1n2zA01 AAPRVITLSPANTELAFAAGITPVGVSSYSDYPPQAQKIEQVSTWQGMNLERIVALKPDLVIAWRGGNAERQVDQLASLG IKVMWVDATSIEQIANALRQLAPWSPQPDKAEQAAQSLL
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"