Domain assigned by auto on 24 Aug 2007 02:27
Assigning to "3.90.25.10" based on similarity with "1kbzA02"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1n2sA01 | 1 | 161 |
| 1n2sA01 | 185 | 220 |
| 1n2sA01 | 265 | 280 |
| 1n2sA02 | 162 | 184 |
| 1n2sA02 | 221 | 264 |
| 1n2sA02 | 281 | 298 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1n2sA02 FAKTMLRLAKERQTLSVINDQYGTTWHDYAALVFDEARKAGITLALTELNAVPTSAYPTPASRPGNSQWELGVKRMLTEM FTTTT
Assigning to "3.90.25.10" based on similarity with "1kbzA02"
No in_process hits for Domain "1n2sA02" ready to be processed
NW result present for Domain "1n2sA02"
All required files are present for Domain "1n2sA02"
Beginning processing for Domain "1n2sA02"
nice chopping