Set cath from cathlist by auto on 05 Mar 2006 18:20
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1n2aA01 | 1 | 82 |
| 1n2aA01 | 189 | 201 |
| 1n2aA02 | 83 | 188 |
There are 11 matching structural neighberhood comparisons for CATH ID 1.20.1050.10.19.1.1.1.1 (SIMAX score < 5)
>pdb|1n2aA02 LAPVNSISRYKTIEWLNYIATELHKGFTPLFRPDTPEEYKPTVRAQLEKKLQYVNEALKDEHWICGQRFTIADAYLFTVL RWAYAVKLNLEGLEHIAAFMQRMAER
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"