CATH Domain: 1n2aA02 XML data for domain: 1n2aA02

Molscript image for 1n2aA02
1n2aA02
PDB coordinates for domain 1n2aA02

PDB 1n2a, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1050 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2
1.20.1050.10 Gene3D
1.20.1050.10.19
1.20.1050.10.19.1
1.20.1050.10.19.1.1
1.20.1050.10.19.1.1.1
1.20.1050.10.19.1.1.1.1

[top]
Segment boundaries for domain 1n2aA02

Chopping figure for domain 1n2aA02
DomainStart PDB ResidueStop PDB Residue
1n2aA01 1 82
1n2aA01 189 201
1n2aA02 83 188

Structural Neighbourhood (11 entries)

There are 11 matching structural neighberhood comparisons for CATH ID 1.20.1050.10.19.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 11 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2dsaA02 92.93 Glutathione S-transferase [EC:2.5.1.18]Metabolism of xenobiotics by cytochrome P450Glutathione S-transferaseGlutathione metabolismBurkholderia xenovorans LB400 1.20.1050.10 106 36 100 1.39 1.39
1aw9A02 85.36 Glutathione transferase III(A)Zea mays 1.20.1050.10 121 19 85 3.14 3.69
1v2aA02 84.88 Anopheles dirusGlutathione transferase gst1-6 1.20.1050.10 132 16 79 2.41 3.03
1gnwA02 84.77 Glutathione bindingMicrosomeChloroplast stromaPlasma membraneToxin catabolic process 1.20.1050.10 125 14 84 2.83 3.34
1hqoA02 84.75 Soluble fractionCytosolProtein URE2Cytoplasmic sequestering of transcription factorProtein urmylation 1.20.1050.10 126 10 80 2.36 2.92
2gsqA02 83.82 Ommastrephes sloaniGlutathione S-transferase 1.20.1050.10 108 15 90 2.34 2.58
1nhyA02 83.52 Positive regulation of transcription from RNA polymerase II promoterCalcium ion bindingNucleusElongation factor 1-gamma 1Transcription coactivator activity 1.20.1050.10 139 11 75 2.34 3.10
1gwcA02 82.85 Aegilops tauschiiGlutathione S-transferase 1 1.20.1050.10 141 20 73 2.54 3.44
3cbuA02 82.13 Glutathione S-transferase [EC:2.5.1.18]Ralstonia eutropha JMP134Metabolism of xenobiotics by cytochrome P450Probable gst-related proteinGlutathione metabolism 1.20.1050.10 132 15 78 2.71 3.47
2vo4A02 81.57 2,4-D inducible glutathione S-transferaseGlycine max 1.20.1050.10 132 16 75 2.41 3.18
2c3nA02 80.02 Soluble fractionGlutathione S-transferase theta-1Glutathione metabolic processGlutathione transferase activityGlutathione metabolism 1.20.1050.10 160 18 65 2.48 3.78
[1]
Displaying entries 1 to 11 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1n2aA02
LAPVNSISRYKTIEWLNYIATELHKGFTPLFRPDTPEEYKPTVRAQLEKKLQYVNEALKDEHWICGQRFTIADAYLFTVL
RWAYAVKLNLEGLEHIAAFMQRMAER
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1n2aA02
LAPVNSISRYKTIEWLNYIATELHKGFTPLFRPDTPEEYKPTVRAQLEKKLQYVNEALKDEHWICGQRFTIADAYLFTVL
RWAYAVKLNLEGLEHIAAFMQRMAER
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:20

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:20

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:18

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"