CATH Domain: 1n1fA00 XML data for domain: 1n1fA00

Molscript image for 1n1fA00
1n1fA00
PDB coordinates for domain 1n1fA00

PDB 1n1f, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1250 Growth Hormone; Chain: A;
1.20.1250.10 Gene3D
1.20.1250.10.8
1.20.1250.10.8.1
1.20.1250.10.8.1.1
1.20.1250.10.8.1.1.1
1.20.1250.10.8.1.1.1.1

[top]
Segment boundaries for domain 1n1fA00

Chopping figure for domain 1n1fA00
DomainStart PDB ResidueStop PDB Residue
1n1fA00 4 159

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 1.20.1250.10.8.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1b5lA00 80.29 Interferon tau-1Ovis aries 1.20.1250.10 152 7 93 4.21 4.50
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1n1fA00
NHGLRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKIL
RKISSIANSFLYMQKTLRQCQQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMSSA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1n1fA00
SVDNHGLRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNP
KILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMSSA
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:20

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:20

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 14:42

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"