CATH Domain: 1n1bB02 XML data for domain: 1n1bB02

Molscript image for 1n1bB02
1n1bB02
PDB coordinates for domain 1n1bB02

PDB 1n1b, Chain B, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.600 Farnesyl Diphosphate Synthase
1.10.600.10 Farnesyl Diphosphate Synthase Gene3D
1.10.600.10.6
1.10.600.10.6.1
1.10.600.10.6.1.1
1.10.600.10.6.1.1.1
1.10.600.10.6.1.1.1.1

[top]
Segment boundaries for domain 1n1bB02

Chopping figure for domain 1n1bB02
DomainStart PDB ResidueStop PDB Residue
1n1bB01 80 285
1n1bB02 286 598

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 1.10.600.10.6.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
5eauA02 85.80 Nicotiana tabacumAristolochene synthase 1.10.600.10 362 30 82 1.85 2.24
1ps1A00 80.89 Streptomyces sp. UC5319Pentalenene synthase 1.10.600.10 304 9 87 3.77 4.31
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1n1bB02
IQATHQQELKDLSRWWSRLCFPEKLPFVRDRLVESFFWAVGMFEPHQHGYQRKMAATIIVLATVIDDIYDVYGTLDELEL
FTDTFKRWDTESITRLPYYMQLCYWGVHNYISDAAYDILKEHGFFCLQYLRKSVVDLVEAYFHEAKWYHSGYTPSLDEYL
NIAKISVASPAIISPTYFTFANASHDTAVIDSLYQYHDILCLAGIILRLPDDLGTDVPKTIQCYMKETNASEEEAVEHVK
FLIREAWKDMNTAIAAGYPFPDGMVAGAANIGRVAQFIYLHGDGFSKTYEHIAGLLFEPYA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1n1bB02
IQATHQQELKDLSRWWSRLCFPEKLPFVRDRLVESFFWAVGMFEPHQHGYQRKMAATIIVLATVIDDIYDVYGTLDELEL
FTDTFKRWDTESITRLPYYMQLCYWGVHNYISDAAYDILKEHGFFCLQYLRKSVVDLVEAYFHEAKWYHSGYTPSLDEYL
NIAKISVASPAIISPTYFTFANASHDTAVIDSLYQYHDILCLAGIILRLPDDLGTSYFELARGDVPKTIQCYMKETNASE
EEAVEHVKFLIREAWKDMNTAIAAGYPFPDGMVAGAANIGRVAQFIYLHGDGFGVQHSKTYEHIAGLLFEPYA
BLAST against CATH

[top]
Domain History Events (5)

Classification merge by cuff on 26 Apr 2006 12:34

COMMENT: Lesley - Scores and superpositions are marginal. Functionally similar - terpenoid biosynthesis pathway. SCOP has these proteins assigned to same fold and superfamily so merge. SCOP uses the name: Fold: Terpenoid synthases FINAL: Lesley - Merge for the above stated reasons.

Flow stage update by cuff on 26 Apr 2006 12:34

COMMENT: Lesley - Scores and superpositions are marginal. Functionally similar - terpenoid biosynthesis pathway. SCOP has these proteins assigned to same fold and superfamily so merge. SCOP uses the name: Fold: Terpenoid synthases FINAL: Lesley - Merge for the above stated reasons.

Set cath from cathlist by auto on 05 Mar 2006 18:14

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:14

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:17

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"