CATH Domain: 1n0zA00 XML data for domain: 1n0zA00

Molscript image for 1n0zA00
1n0zA00
PDB coordinates for domain 1n0zA00

PDB 1n0z, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
4 Few Secondary Structures
4.10 Irregular
4.10.1060 ZNF265 like
4.10.1060.10 Znf265, first zinc-finger domain Gene3D
4.10.1060.10.1
4.10.1060.10.1.1
4.10.1060.10.1.1.1
4.10.1060.10.1.1.1.1
4.10.1060.10.1.1.1.1.1

[top]
Segment boundaries for domain 1n0zA00

Chopping figure for domain 1n0zA00
DomainStart PDB ResidueStop PDB Residue
1n0zA00 1 45

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 4.10.1060.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1d66B01 66.77 Regulatory protein GAL4NucleusSequence-specific DNA binding transcription factor activityPositive regulation of transcription by galactoseTranscription activator activity 4.10.240.10 33 15 55 2.35 4.23
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1n0zA00
GSMSTKNFRVSDGDWICPDKKCGNVNFARRTSCDRCGREKTTGPI
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1n0zA00
GSMSTKNFRVSDGDWICPDKKCGNVNFARRTSCDRCGREKTTGPI
BLAST against CATH

[top]
Domain History Events (3)

Insertion by sillitoe on 06 Mar 2006 15:53

HomCheck 'New T' domains

Flow stage update by sillitoe on 06 Mar 2006 15:53

HomCheck 'New T' domains

Insertion by auto on 05 Mar 2006 16:05

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"