CATH Domain: 1mxiA00 XML data for domain: 1mxiA00

Molscript image for 1mxiA00
1mxiA00
PDB coordinates for domain 1mxiA00

PDB 1mxi, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.1280 Alpha/beta knot
3.40.1280.10 Gene3D
3.40.1280.10.2
3.40.1280.10.2.1
3.40.1280.10.2.1.1
3.40.1280.10.2.1.1.1
3.40.1280.10.2.1.1.1.1

[top]
Segment boundaries for domain 1mxiA00

Chopping figure for domain 1mxiA00
DomainStart PDB ResidueStop PDB Residue
1mxiA00 1 156

Structural Neighbourhood (9 entries)

There are 9 matching structural neighberhood comparisons for CATH ID 3.40.1280.10.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 9 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2i6dA02 86.05 RNA methyltransferase, TrmH familyPorphyromonas gingivalis 3.40.1280.10 152 15 89 2.35 2.62
1x7oA02 85.94 RRNA methyltransferaseStreptomyces viridochromogenes 3.40.1280.10 166 20 89 3.56 3.97
1gz0B02 84.70 RRNA (guanosine-2'-O-)-methyltransferase activityEnzyme-directed rRNA 2'-O-methylationRNA methyltransferase, TrmH family [EC:2.1.1.-]Escherichia coli K-1223S rRNA (guanosine-2'-O-)-methyltransferase rlmB 3.40.1280.10 161 16 88 2.58 2.93
1v2xA00 83.37 TRNA (guanosine-2'-O-)-methyltransferase [EC:2.1.1.34]TRNA (Gm18) methyltransferaseThermus thermophilus 3.40.1280.10 191 21 78 3.27 4.19
1vhkA02 81.71 Bacillus subtilisRibosomal RNA small subunit methyltransferase ERibosomal RNA small subunit methyltransferase E [EC:2.1.1.-] 3.40.1280.10 160 10 86 3.97 4.60
1v6zA02 81.06 Thermus thermophilus HB27Ribosomal RNA small subunit methyltransferase E [EC:2.1.1.-]Hypothetical conserved protein 3.40.1280.10 161 8 86 3.65 4.20
2o3aB00 80.47 Hypothetical proteinArchaeoglobus fulgidusTRNA ribose 2'-O-methyltransferase aTrm56 3.40.1280.10 163 10 81 3.36 4.12
3dcmX00 80.43 Thermotoga maritimaUncharacterized protein TM_1570 3.40.1280.10 188 11 77 3.44 4.43
1k3rA01 78.06 Hypothetical proteinMethanothermobacter thermautotrophicus str. Delta HConserved protein 3.40.1280.10 191 14 74 3.42 4.57
[1]
Displaying entries 1 to 9 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1mxiA00
MLDIVLYEPEIPQNTGNIIRLCANTGFRLHLIEPLGFTWDDKRLRRSGLDYHEFAEIKRHKTFEAFLESEKPKRLFALTT
KGCPAHSQVKFKLGDYLMFGPETRGIPMSILNEMPMEQKIRIPMTANSRSMNLSNSVAVTVYEAWRQLGYKGAVNL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1mxiA00
MLDIVLYEPEIPQNTGNIIRLCANTGFRLHLIEPLGFTWDDKRLRRSGLDYHEFAEIKRHKTFEAFLESEKPKRLFALTT
KGCPAHSQVKFKLGDYLMFGPETRGIPMSILNEMPMEQKIRIPMTANSRSMNLSNSVAVTVYEAWRQLGYKGAVNLPEVK
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:29

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:29

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:52

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"