Domain assigned by auto on 20 Oct 2008 14:27
Assigning to "2.60.40.1180" based on similarity with "1mwoA02"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1mxgA01 | 1 | 337 |
| 1mxgA02 | 338 | 435 |
There are 23 matching structural neighberhood comparisons for CATH ID 2.60.40.1180.3.1.1.1.1 (SIMAX score < 5)
>pdb|1mxgA02 GGSTTIVYYDNDELIFVRNGDSRRPGLITYINLSPNWVGRWVYVPKFAGACIHEYTGNLGGWVDKRVDSSGWVYLEAPPH DPANGYYGYSVWSYCGVG
Assigning to "2.60.40.1180" based on similarity with "1mwoA02"
No in_process hits for Domain "1mxgA02" ready to be processed
Domain "1mxgA02" hits Domain "1mxdA02" (100% over 100%) which is currently in process
Domain "1mxgA02" hits Domain "1mwoA02" (100% over 100%) which is currently in process
Domain "1mxgA02" hits Domain "1mwoA02" (100% over 100%) which is currently in process
Domain "1mxgA02" hits Domain "1mwoA02" (100% over 100%) which is currently in process
Domain "1mxgA02" hits Domain "1mwoA02" (100% over 100%) which is currently in process
Domain "1mxgA02" hits Domain "1mwoA02" (100% over 100%) which is currently in process
NW result present for Domain "1mxgA02"
All required files are present for Domain "1mxgA02"
Beginning processing for Domain "1mxgA02"
nice chopping