CATH Domain: 1mwwB00 XML data for domain: 1mwwB00

Molscript image for 1mwwB00
1mwwB00
PDB coordinates for domain 1mwwB00

PDB 1mww, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.429 Macrophage Migration Inhibitory Factor
3.30.429.10 Macrophage Migration Inhibitory Factor Gene3D
3.30.429.10.6
3.30.429.10.6.1
3.30.429.10.6.1.1
3.30.429.10.6.1.1.1
3.30.429.10.6.1.1.1.1

[top]
Segment boundaries for domain 1mwwB00

Chopping figure for domain 1mwwB00
DomainStart PDB ResidueStop PDB Residue
1mwwB00 1 118

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.30.429.10.6.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3c6vA00 81.89 Aspergillus fumigatusPutative uncharacterized protein 3.30.429.10 140 13 82 2.94 3.58
1otgA00 81.80 Escherichia coli5-carboxymethyl-2-hydroxymuconate Delta-isomerase 3.30.429.10 125 11 92 4.53 4.88
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1mwwB00
MITVFGLKSKLAPRREKLAEVIYNSLHLGLDIPKGKHAIRFLCLEKEDFYYPFDRSDDYTVIEINLMAGRMEGTKKRLIK
MLFSELEYKLGIRAHDVEITIKEQPAHCWGFRGMTGDE
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1mwwB00
MITVFGLKSKLAPRREKLAEVIYNSLHLGLDIPKGKHAIRFLCLEKEDFYYPFDRSDDYTVIEINLMAGRMEGTKKRLIK
MLFSELEYKLGIRAHDVEITIKEQPAHCWGFRGMTGDEARDLDYDIYV
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:05

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:05

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:29

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"