Set cath from cathlist by auto on 05 Mar 2006 18:08
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1mw9X01 | 2 | 163 |
| 1mw9X02 | 164 | 212 |
| 1mw9X02 | 474 | 587 |
| 1mw9X03 | 213 | 279 |
| 1mw9X03 | 405 | 473 |
| 1mw9X04 | 280 | 404 |
There are 2 matching structural neighberhood comparisons for CATH ID 1.10.290.10.1.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1gkuB08 | 91.36 | 1.10.290.10 | 119 | 30 | 87 | 1.47 | 1.68 | |
![]() |
1i7dA04 | 86.42 | 1.10.290.10 | 127 | 24 | 87 | 3.24 | 3.71 |
>pdb|1mw9X04 PGAPFITSTLQQAASTRLGFGVKKTMMMAQRLYEAGYITYMRTDSTNLSQDAVNMVRGYISDNFGKKYLPESPNQYAREA IRPSDVNVMAESLKDMEADAQKLYQLIWRQFVACQMT
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"