CATH Domain: 1mw7A03 XML data for domain: 1mw7A03

Molscript image for 1mw7A03
1mw7A03
PDB coordinates for domain 1mw7A03

PDB 1mw7, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.70 Alpha-Beta Plaits
3.30.70.980 Gene3D
3.30.70.980.2
3.30.70.980.2.1
3.30.70.980.2.1.1
3.30.70.980.2.1.1.1
3.30.70.980.2.1.1.1.1

[top]
Segment boundaries for domain 1mw7A03

Chopping figure for domain 1mw7A03
DomainStart PDB ResidueStop PDB Residue
1mw7A01 21 78
1mw7A02 79 130
1mw7A02 206 240
1mw7A03 131 205

Structural Neighbourhood (25 entries)

There are 25 matching structural neighberhood comparisons for CATH ID 3.30.70.980.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 25 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1konA03 87.58 UPF0082 protein yebCEscherichia coli K-12 3.30.70.980 75 17 90 1.84 2.03
1u7lA01 79.48 V-type H+-transporting ATPase subunit C [EC:3.6.3.14]Oxidative phosphorylationVacuolar acidificationProtein bindingVacuolar proton-transporting V-type ATPase, V1 domain 3.30.70.1180 91 6 75 2.69 3.55
1utaA00 79.24 Membrane fractionCell cycle cytokinesisCell division protein FtsNCell division protein ftsNProtein binding 3.30.70.1070 77 2 89 3.18 3.55
2fgcA03 79.11 Butanoate metabolismC5-Branched dibasic acid metabolismPantothenate and CoA biosynthesisValine, leucine and isoleucine biosynthesisMetabolic pathways 3.30.70.1150 74 6 86 4.09 4.72
2fmrA00 79.02 CytoplasmSoluble fractionNucleolusHomo sapiensFragile X mental retardation 1 protein 3.30.1370.10 65 9 76 3.25 4.28
1yx2A02 78.78 Nitrogen metabolismAminomethyltransferase [EC:2.1.2.10]One carbon pool by folateBacillus subtilisGlycine, serine and threonine metabolism 3.30.70.1400 81 6 74 3.00 4.05
2nzcA00 78.27 Thermotoga maritimaPutative uncharacterized protein 3.30.70.1150 77 6 89 4.01 4.47
2anrA02 78.20 RNA-binding protein Nova-1Synaptic transmissionHomo sapiensLocomotory behavior 3.30.1370.10 74 4 90 4.29 4.73
1usmA00 78.14 Transcriptional coactivatorThermus thermophilus 3.30.1360.20 77 4 84 4.03 4.77
3proC02 78.13 Lysobacter enzymogenesAlpha-lytic protease 3.30.300.50 70 7 86 4.15 4.79
1wj9A01 78.05 Thermus thermophilus HB8Putative uncharacterized protein TTHB192 3.30.70.1200 87 4 72 2.86 3.95
2hiyB01 77.93 Streptococcus pneumoniaePutative uncharacterized protein 3.30.70.1280 87 14 85 3.93 4.62
2axyA00 76.62 Poly(rC)-binding protein 2CytoplasmRNA bindingHomo sapiensProtein binding 3.30.1370.10 69 8 84 3.80 4.52
1zzkA00 76.48 SpliceosomeHeterogeneous nuclear ribonucleoprotein KRNA bindingHeterogeneous nuclear ribonucleoprotein KProtein binding 3.30.1370.10 80 5 83 3.78 4.51
1dtjA00 76.29 RNA-binding protein Nova-2Homo sapiens 3.30.1370.10 74 4 76 3.27 4.30
2x3dF01 75.81 Hypothetical proteinSulfolobus solfataricusPutative uncharacterized protein 3.30.70.1340 84 12 80 3.78 4.67
1vlyA02 75.76 RNA modificationTRNA-modifying protein ygfZFolic acid bindingEscherichia coli K-12 3.30.70.1400 84 5 80 3.86 4.77
1wr8A02 75.62 Pyrococcus horikoshiiPhosphoglycolate phosphatase 3.90.1070.10 69 10 77 3.86 4.99
1rwuA00 75.34 Hypothetical proteinUPF0250 protein ybeDEscherichia coli K-12 3.30.70.1460 87 8 73 3.65 4.96
2qyxB01 75.28 3.30.70.1360 109 14 59 2.63 4.41
1j4wA01 75.19 Transcription from RNA polymerase II promoterFar upstream element-binding proteinSequence-specific DNA binding transcription factor activityFar upstream element-binding protein 1Nucleus 3.30.1370.10 74 5 85 3.97 4.65
3c19A01 73.45 Methanopyrus kandleriUncharacterized conserved protein 3.30.70.1380 98 2 75 3.54 4.69
2hekA02 72.95 Aquifex aeolicusPutative uncharacterized protein 3.30.70.1370 88 9 59 2.78 4.70
1vigA00 72.28 CytoplasmVigilinCholesterol metabolic processPlasma membraneHomo sapiens 3.30.1370.10 71 5 74 3.57 4.78
2qyxA02 71.91 3.30.70.1360 113 6 48 2.32 4.77
[1]
Displaying entries 1 to 25 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1mw7A03
FNRKSVFECLKNEVENLKLSLEDLEFALIDYGLEELEEVEDKIIIRGDYNSFKLLNEGFESLKLPILKASLQRIA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1mw7A03
FNRKSVFECLKNEVENLKLSLEDLEFALIDYGLEELEEVEDKIIIRGDYNSFKLLNEGFESLKLPILKASLQRIA
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:01

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:01

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:17

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"