Set cath from cathlist by auto on 05 Mar 2006 19:09
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1mw7A01 | 21 | 78 |
| 1mw7A02 | 79 | 130 |
| 1mw7A02 | 206 | 240 |
| 1mw7A03 | 131 | 205 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1mw7A02 SEITYEGKANFGVLIIMECMTDNPTRTIANLKSYFNKTQGASIVPNGSLEFMTTPIELNDEQMELTEKLLDRIEDDDDVV ALYTNIE
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"