CATH Domain: 1mu5A01 XML data for domain: 1mu5A01

Molscript image for 1mu5A01
1mu5A01
PDB coordinates for domain 1mu5A01

PDB 1mu5, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.565 Heat Shock Protein 90
3.30.565.10 Gene3D
3.30.565.10.6
3.30.565.10.6.1
3.30.565.10.6.1.1
3.30.565.10.6.1.1.1
3.30.565.10.6.1.1.1.1

[top]
Segment boundaries for domain 1mu5A01

Chopping figure for domain 1mu5A01
DomainStart PDB ResidueStop PDB Residue
1mu5A01 10 220
1mu5A02 230 307
1mu5A03 315 470

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 3.30.565.10.6.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3fv5B00 83.02 CytoplasmPlasmid partitioningTopoisomerase IV subunit B [EC:5.99.1.-]DNA topoisomerase 4 subunit BSister chromatid cohesion 3.30.565.10 181 18 79 2.39 3.02
1s14B00 82.24 CytoplasmPlasmid partitioningTopoisomerase IV subunit B [EC:5.99.1.-]DNA topoisomerase 4 subunit BSister chromatid cohesion 3.30.565.10 178 17 77 2.26 2.93
1h7sA01 81.23 DNA mismatch repair protein PMS2Mismatch repair endonuclease PMS2Single base insertion or deletion bindingHomo sapiensMismatch repair 3.30.565.10 191 15 76 3.31 4.34
1pvgA01 79.80 Reciprocal meiotic recombinationDNA topoisomerase 2Regulation of mitotic recombinationDNA topoisomerase II [EC:5.99.1.3]DNA strand elongation involved in DNA replication 3.30.565.10 238 15 78 3.34 4.25
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1mu5A01
LSPAEFFKRNPELAGFPNPARALYQTVRELIENSLDATDVHGILPNIKITIDLIDDARQIYKVNVVDNGIGIPPQEVPNA
FGRVLYSKYVNRQTRGMYGLGVKAAVLYSQMHQDKPIEIETSPVNSKRIYTFKLKIDINKNEPIIVERGSVENTRGFHGT
SVAISIPGDWPKAKSRIYEYIKRTYIITPYAEFIFKDPEGNVTYYPRLTN
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1mu5A01
GASAKEKFTSLSPAEFFKRNPELAGFPNPARALYQTVRELIENSLDATDVHGILPNIKITIDLIDDARQIYKVNVVDNGI
GIPPQEVPNAFGRVLYSSKYVNRQTRGMYGLGVKAAVLYSQMHQDKPIEIETSPVNSKRIYTFKLKIDINKNEPIIVERG
SVENTRGFHGTSVAISIPGDWPKAKSRIYEYIKRTYIITPYAEFIFKDPEGNVTYYPRLTN
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:07

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:07

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:16

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"