CATH Domain: 1mtpA01 XML data for domain: 1mtpA01

Molscript image for 1mtpA01
1mtpA01
PDB coordinates for domain 1mtpA01

PDB 1mtp, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.497 Antithrombin; Chain I, domain 2
3.30.497.10 Antithrombin, subunit I, domain 2 Gene3D
3.30.497.10.1
3.30.497.10.1.1
3.30.497.10.1.1.1
3.30.497.10.1.1.1.1
3.30.497.10.1.1.1.1.1

[top]
Segment boundaries for domain 1mtpA01

Chopping figure for domain 1mtpA01
DomainStart PDB ResidueStop PDB Residue
1mtpA01 5 167
1mtpA01 259 323
1mtpA02 168 258

Structural Neighbourhood (13 entries)

There are 13 matching structural neighberhood comparisons for CATH ID 3.30.497.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 13 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2arrA01 89.56 Anti-apoptosisHomo sapiensPlasminogen activator inhibitor 2 3.30.497.10 222 27 92 1.82 1.96
3f02B01 89.42 Peripheral nervous system developmentNeuroserpinHomo sapiensCentral nervous system developmentSerine-type endopeptidase inhibitor activity 3.30.497.10 219 22 93 2.10 2.25
3dy0A01 89.26 MembraneAcrosin bindingHeparin bindingExtracellular regionSerine-type endopeptidase inhibitor activity 3.30.497.10 217 27 89 1.87 2.10
1wz9A01 86.93 CytoplasmCellular component movementP53 signaling pathwaySerpin peptidase inhibitor, clade B, member 5Homo sapiens 3.30.497.10 219 21 92 2.91 3.16
1lj5A01 86.92 Plasminogen activator inhibitor-1Positive regulation of monocyte chemotaxisChagas diseaseCellular response to chemical stimulusNegative regulation of endopeptidase activity 3.30.497.10 225 24 90 2.65 2.93
1uhgA02 86.73 OvalbuminGallus gallus 3.30.497.10 232 20 90 2.48 2.74
1jmoA01 85.00 Heparin cofactor IIHomo sapiensHeparin cofactor 2Complement and coagulation cascades 3.30.497.10 227 20 90 2.83 3.12
1f0cA01 84.92 Serine proteinase inhibitor 2Cowpox virus (Brighton Red) 3.30.497.10 161 25 69 1.63 2.34
1k9oI01 83.80 Manduca sextaAlaserpinProtein binding 3.30.497.10 215 22 88 2.96 3.36
2b5tI01 83.74 Antithrombin IIIProtease bindingHomo sapiensAntithrombin-IIIExtracellular space 3.30.497.10 259 22 82 2.61 3.16
1imvA02 82.58 Negative regulation of angiogenesisHomo sapiensPigment epithelium-derived factorPositive regulation of neurogenesisCell proliferation 3.30.497.10 206 21 86 3.04 3.52
1jjoC01 80.62 Mus musculusNeuroserpin 3.30.497.10 149 19 60 1.93 3.19
1m93B01 80.01 Serine proteinase inhibitor 2Cowpox virus (Brighton Red) 3.30.497.10 127 25 55 1.48 2.66
[1]
Displaying entries 1 to 13 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1mtpA01
GGFLRDDHLEFALHLHRRLAEAVPDGEVIWSPYSVACALGVLAAGARATTRTELTTLLGTDPAPLLAALDRAVTDSPDLA
SRTVLWVSADVPVRSSFRATMHDRPDSDVRTADFRTNPEGVRATVNADIADATRGMIRELLPQGAVTPDLRAILTNALWA
KARFELTQPHQLVEVLAEAGVRTLFTASADLSGISTVPLYVDTVIHQARLRVDERGAEGAAATAAMML
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1mtpA01
MSGGFLRDDHLEFALHLHRRLAEAVPDGEVIWSPYSVACALGVLAAGARATTRTELTTLLGTDPAPLLAALDRAVTDSPD
LASRTVLWVSADVPVRSSFRATMHDRPDSDVRTADFRTNPEGVRATVNADIADATRGMIRELLPQGAVTPDLRAILTNAL
WAKARFELTQPHQLVEVLAEAGVRTLFTASADLSGISTVPLYVDTVIHQARLRVDERGAEGAAATAAMML
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:06

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:06

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:16

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"