CATH Domain: 1mszA00 XML data for domain: 1mszA00

Molscript image for 1mszA00
1mszA00
PDB coordinates for domain 1mszA00

PDB 1msz, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.1370 Ribosomal Protein S8; Chain: A, domain 1
3.30.1370.50 Gene3D
3.30.1370.50.2
3.30.1370.50.2.1
3.30.1370.50.2.1.1
3.30.1370.50.2.1.1.1
3.30.1370.50.2.1.1.1.1

[top]
Segment boundaries for domain 1mszA00

Chopping figure for domain 1mszA00
DomainStart PDB ResidueStop PDB Residue
1mszA00 725 786

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 3.30.1370.50.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1ug8A00 82.06 Mus musculusPoly(A)-specific ribonuclease PARN 3.30.1370.50 87 25 70 2.40 3.42
1dcjA00 76.34 Sulfurtransferase tusATRNA 2-thiouridine synthesizing protein A [EC:2.8.1.-]Escherichia coli K-12 3.30.110.40 81 8 69 3.35 4.85
1je3A01 76.13 UPF0033 protein yedFEscherichia coli K-12 3.30.110.40 73 17 79 3.85 4.85
1repC02 74.78 Escherichia coli K-12Replication initiation protein 1.10.10.10 91 8 68 3.35 4.92
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1mszA00
GVDHFRAMIVEFMASKKMQLEFPPSLNSHDRLRVHQIAEEHGLRHDSSGEGKRRFITVSKRA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1mszA00
GVDHFRAMIVEFMASKKMQLEFPPSLNSHDRLRVHQIAEEHGLRHDSSGEGKRRFITVSKRAGSHHHHHH
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:09

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:09

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:33

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"