Set cath from cathlist by auto on 05 Mar 2006 19:24
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1mqiA01 | 110 | 218 |
| 1mqiA02 | 4 | 109 |
| 1mqiA02 | 219 | 258 |
There are 10 matching structural neighberhood comparisons for CATH ID 3.40.190.10.5.2.1.1.1 (SIMAX score < 5)
>pdb|1mqiA02 KTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKA DIAIAPLTITLVREEVIDFSKPFMSLGYGIATPKGSSLGNAVNLAVLKLNEQGLLDKLKNKWWYDK
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"