CATH Domain: 1mpgA03 XML data for domain: 1mpgA03

Molscript image for 1mpgA03
1mpgA03
PDB coordinates for domain 1mpgA03

PDB 1mpg, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.1670 Endonuclease Iii, domain 2
1.10.1670.10 Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) Gene3D
1.10.1670.10.7
1.10.1670.10.7.1
1.10.1670.10.7.1.1
1.10.1670.10.7.1.1.1
1.10.1670.10.7.1.1.1.1

[top]
Segment boundaries for domain 1mpgA03

Chopping figure for domain 1mpgA03
DomainStart PDB ResidueStop PDB Residue
1mpgA01 1 112
1mpgA02 113 230
1mpgA03 231 282

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 1.10.1670.10.7.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1qo0D02 82.07 Pseudomonas aeruginosaAliphatic amidase regulator 1.10.10.10 46 10 78 3.61 4.58
1s8nA02 79.80 Response regulator NasTProbable transcriptional regulatory protein pdtaRMycobacterium tuberculosis 1.10.10.10 58 13 77 3.72 4.79
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1mpgA03
KDVFLPDDYLIKQRFPGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQPDEA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1mpgA03
KDVFLPDDYLIKQRFPGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQPDEA
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:17

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:17

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:16

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"