CATH Domain: 1mpgA02 XML data for domain: 1mpgA02

Molscript image for 1mpgA02
1mpgA02
PDB coordinates for domain 1mpgA02

PDB 1mpg, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.340 Endonuclease III; domain 1
1.10.340.30 Hypothetical protein; domain 2 Gene3D
1.10.340.30.5
1.10.340.30.5.1
1.10.340.30.5.1.1
1.10.340.30.5.1.1.1
1.10.340.30.5.1.1.1.1

[top]
Segment boundaries for domain 1mpgA02

Chopping figure for domain 1mpgA02
DomainStart PDB ResidueStop PDB Residue
1mpgA01 1 112
1mpgA02 113 230
1mpgA03 231 282

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 1.10.340.30.5.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1ornA01 85.72 1.10.340.30 112 19 84 2.57 3.03
1keaA02 84.28 G/T mismatches repair enzymeMethanothermobacter thermautotrophicus 1.10.340.30 113 14 82 2.58 3.14
1ngnA00 77.45 DNA damage response, signal transduction resulting in induction of apoptosisDNA methylationNucleusChromatinMus musculus 1.10.340.30 144 13 63 2.86 4.48
1y88A02 75.35 Archaeoglobus fulgidusUncharacterized protein AF_1548 1.10.150.20 59 13 49 2.39 4.86
1wcnA01 73.33 N utilization substance protein ATranscription elongation protein nusAEscherichia coli K-12 1.10.150.20 60 18 49 2.35 4.78
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1mpgA02
AFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPEYICFPTPQRLAAADPQALKALGMPLKRAEALIHLANAALEG
TLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1mpgA02
AFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPEYICFPTPQRLAAADPQALKALGMPLKRAEALIHLANAALEG
TLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQA
BLAST against CATH

[top]
Domain History Events (5)

Classification merge by cuff on 25 Apr 2006 18:16

COMMENT: Mark - Clearly a homology missed during Homcheck FINAL: Lesley - Yes, clearly related. Mark, why were these not picked up during homolcheck???Lesley - Conservatively, Merge 10 into 30 for now, until better HMM hits allow us to clearly bring it into 10. They have strong functional correlations but the HMM hits are no present to any previously existing members of 10. Only a new one going into 10 and that call now being reconsidered in light of these X-hits.

Flow stage update by cuff on 25 Apr 2006 18:16

COMMENT: Mark - Clearly a homology missed during Homcheck FINAL: Lesley - Yes, clearly related. Mark, why were these not picked up during homolcheck???Lesley - Conservatively, Merge 10 into 30 for now, until better HMM hits allow us to clearly bring it into 10. They have strong functional correlations but the HMM hits are no present to any previously existing members of 10. Only a new one going into 10 and that call now being reconsidered in light of these X-hits.

Set cath from cathlist by auto on 05 Mar 2006 18:08

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:08

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:16

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"