CATH Domain: 1mo9A03 XML data for domain: 1mo9A03

Molscript image for 1mo9A03
1mo9A03
PDB coordinates for domain 1mo9A03

PDB 1mo9, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.390 Enolase-like; domain 1
3.30.390.30 Gene3D
3.30.390.30.10
3.30.390.30.10.1
3.30.390.30.10.1.1
3.30.390.30.10.1.1.1
3.30.390.30.10.1.1.1.1

Segment boundaries for domain 1mo9A03

Chopping figure for domain 1mo9A03
DomainStart PDB ResidueStop PDB Residue
1mo9A01 2 85
1mo9A01 132 186
1mo9A01 314 378
1mo9A02 87 131
1mo9A02 197 244
1mo9A02 270 311
1mo9A03 254 268
1mo9A03 386 523

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.30.390.30.10.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1ebdA03 82.24 Dihydrolipoyl dehydrogenaseGeobacillus stearothermophilus 3.30.390.30 115 19 74 2.36 3.17
Displaying entries 1 to 1 (page 1 of 1)


Domain ATOM Sequence

>pdb|1mo9A03
DNETRAYVLDRMKEQNYPDFLHTHYEVSFLGMGEEEARAAGHEIVTIKMPPDTENGLNVALPASDRTMLYAFGKGTAHMS
GFQKIVIDAKTRKVLGAHHVGYGAKDAFQYLNVLIKQGLTVDELGDMDELFLNPTHFIQLSRLRAGSKNLVSL    

Domain COMBS Sequence

>pdb|1mo9A03
DNETRAYVLDRMKEQNYPDFLHTHYEVSFLGMGEEEARAAGHEIVTIKMPPDTENGLNVALPASDRTMLYAFGKGTAHMS
GFQKIVIDAKTRKVLGAHHVGYGAKDAFQYLNVLIKQGLTVDELGDMDELFLNPTHFIQLSRLRAGSKNLVSL    

Domain History Events (2)

Domain assigned by lewis on 09 Aug 2006 17:12

Automatically fixing a bunch of choppings that have domains with misordered segments. Here the domain is being reassigned back to its original superfamily. This work is done under ticket:98.

Insertion by lewis on 09 Aug 2006 17:12

Automatically fixing a bunch of choppings that have domains with misordered segments. Here the chopping is being reinserted but with the segments reordered in the domains. The domains should not be reordered. This work is done under ticket:98.