Domain assignment manual match a by tronnberg on 11 Dec 2007 09:51
SSAP: 55.8 OV: 34.30/34.00. I believe that 1c7uA01 should be assigned to the same homology.
CATH Domain: 1mnmB01
1mnmB01
PDB 1mnm, Chain B, Domain 1
This domain is in the HOMCHECK_REVIEW flow stage and therefore has not yet been assigned to a homologous superfamily in CATH. You can view the domain history to see more information.
Structural Neighbourhood ( entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|1mnmB01 NKTRRHVTFSKRKHGIMKKAFELSVLTGTQVLLLVVSETGLVYTFSTPKFEPIVTQQEGRNLIQACLNAPD
Domain History Events (40)
Homcheck review by tronnberg on 11 Dec 2007 09:51
SSAP: 55.8 OV: 34.30/34.00. I believe that 1c7uA01 should be assigned to the same homology.
Flow stage update by tronnberg on 11 Dec 2007 09:51
SSAP: 55.8 OV: 34.30/34.00. I believe that 1c7uA01 should be assigned to the same homology.
Homcheck allotment by tronnberg on 11 Dec 2007 09:48
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by tronnberg on 11 Dec 2007 09:48
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 09 Dec 2007 15:20
Calculated SCOP results for 1mnmB01 and inserted them into the database.
Domain scan scop cath by auto on 09 Dec 2007 15:20
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 1 results for 1mnmB01
Flow stage update by auto on 08 Dec 2007 18:58
Retrieved PRC_PFAMCATH results for job ID SID0601083158556320 and results inserted.
Domain scan prc pfamcath by auto on 08 Dec 2007 18:58
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 1 results for 1mnmB01
Update comment by auto on 08 Dec 2007 14:54
PRC_PFAMCATH job SID0601083158556320 is not yet finished.
Prc pfamcath submit by auto on 08 Dec 2007 14:46
The entry "1mnmB01" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 08 Dec 2007 14:46
The entry "1mnmB01" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 08 Dec 2007 14:40
Retrieved SSAP results for job ID SID7832219386339688 and results inserted.
Domain scan ssap cath by auto on 08 Dec 2007 14:37
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 3022 results for 1mnmB01
Update comment by auto on 08 Dec 2007 03:16
SSAP job SID7832219386339688 is not yet finished.
Flow stage update by auto on 08 Dec 2007 02:53
The entry "1mnmB01" has been submitted to the SSAP webservice.
Ssap cath submit by auto on 08 Dec 2007 02:53
The entry "1mnmB01" has been submitted to the SSAP webservice.
Flow stage update by auto on 08 Dec 2007 02:47
Retrieved PRC results for job ID SID5885123162600840 and inserted them into the database.
Domain scan prc cath by auto on 08 Dec 2007 02:46
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 2 results for 1mnmB01
Update comment by auto on 07 Dec 2007 19:36
PRC job SID5885123162600840 is not yet finished.
Prc cath submit by auto on 07 Dec 2007 19:30
The entry "1mnmB01" has been submitted to the PRC webservice.
Flow stage update by auto on 07 Dec 2007 19:30
The entry "1mnmB01" has been submitted to the PRC webservice.
Flow stage update by auto on 07 Dec 2007 19:23
Retrieved HMM(SAM) results for job ID SID4350927773104608 and inserted them into the database.
Domain scan sam cath by auto on 07 Dec 2007 19:23
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 2 results for 1mnmB01
Update comment by auto on 07 Dec 2007 14:37
HMM(SAM) job SID4350927773104608 is not yet finished.
Flow stage update by auto on 07 Dec 2007 14:31
The entry "1mnmB01" has been submitted to the HMM (SAM) webservice.
Sam cath submit by auto on 07 Dec 2007 14:31
The entry "1mnmB01" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 07 Dec 2007 14:20
Retrieved "1mnmB01" CATHEDRAL results for job ID SID0785481113867834 and inserted them into the database.
Domain scan cathedral cath by auto on 07 Dec 2007 14:19
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 56 results for 1mnmB01
Update comment by auto on 06 Dec 2007 06:24
"1mnmB01" CATHEDRAL job SID0785481113867834 is not yet finished.
Flow stage update by auto on 06 Dec 2007 06:21
The entry "1mnmB01" has been submitted to the CATHEDRAL webservice.
Cathedral cath submit by auto on 06 Dec 2007 06:21
The entry "1mnmB01" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 06 Dec 2007 06:20
ScanList with 11651 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/1mnmB01.scanlist" for "1mnmB01"
Write scan list by auto on 06 Dec 2007 06:19
Writing ScanList containing 11651 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/1mnmB01.scanlist" for domain "1mnmB01"
Flow stage update by auto on 02 Sep 2007 10:12
No satisfactory AssignClose result found.
Flow stage update by auto on 02 Sep 2007 10:04
No in_process hits for Domain "1mnmB01" ready to be processed
Flow stage update by auto on 02 Sep 2007 10:04
NW result present for Domain "1mnmB01"
Flow stage update by auto on 01 Sep 2007 14:04
All required files are present for Domain "1mnmB01"
Flow stage update by auto on 31 Aug 2007 19:48
Beginning processing for Domain "1mnmB01"
Insertion by auto on 31 Aug 2007 18:09
Final ChopClose added based on similarity with "1srsA"
