CATH Domain: 1mlaA02 XML data for domain: 1mlaA02

Molscript image for 1mlaA02
1mlaA02
PDB coordinates for domain 1mlaA02

PDB 1mla, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.366 Malonyl-Coenzyme A Acyl Carrier Protein; domain 2
3.40.366.10 Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 Gene3D
3.40.366.10.2
3.40.366.10.2.1
3.40.366.10.2.1.1
3.40.366.10.2.1.1.1
3.40.366.10.2.1.1.1.1

[top]
Segment boundaries for domain 1mlaA02

Chopping figure for domain 1mlaA02
DomainStart PDB ResidueStop PDB Residue
1mlaA01 125 197
1mlaA02 3 124
1mlaA02 198 307

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.40.366.10.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1nm2A02 89.98 Fatty acid biosynthesisStreptomyces coelicolorMalonyl CoA:acyl carrier protein malonyltransferase[acyl-carrier-protein] S-malonyltransferase [EC:2.3.1.39]Metabolic pathways 3.40.366.10 229 38 98 1.52 1.54
2h1yA01 89.73 Helicobacter pyloriMalonyl coenzyme A-acyl carrier protein transacylase 3.40.366.10 240 32 95 1.37 1.44
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1mlaA02
QFAFVFPGQGSQTVGMLADMAASYPIVEETFAEASAALGYDLWALTQQGPAEELNKTWQTQPALLTASVALYRVWQQQGG
KAPAMMAGHSLGEYSALVCAGVIDFADAVRLVEMRGKFMQEAVPSHCALMKPAADKLAVELAKITFNAPTVPVVNNVDVK
CETNGDAIRDALVRQLYNPVQWTKSVEYMAAQGVEHLYEVGPGKVLTGLTKRIVDTLTASALNEPSAMAAAL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1mlaA02
MTQFAFVFPGQGSQTVGMLADMAASYPIVEETFAEASAALGYDLWALTQQGPAEELNKTWQTQPALLTASVALYRVWQQQ
GGKAPAMMAGHSLGEYSALVCAGVIDFADAVRLVEMRGKFMQEAVPSHCALMKPAADKLAVELAKITFNAPTVPVVNNVD
VKCETNGDAIRDALVRQLYNPVQWTKSVEYMAAQGVEHLYEVGPGKVLTGLTKRIVDTLTASALNEPSAMAAALEL
BLAST against CATH

[top]
Domain History Events (4)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1mla002" to "1mlaA02" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 19:26

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:26

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:15

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"