CATH Domain: 1mk4A00 XML data for domain: 1mk4A00

Molscript image for 1mk4A00
1mk4A00
PDB coordinates for domain 1mk4A00

PDB 1mk4, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.630 Aminopeptidase
3.40.630.30 Gene3D
3.40.630.30.7
3.40.630.30.7.1
3.40.630.30.7.1.1
3.40.630.30.7.1.1.1
3.40.630.30.7.1.1.1.1

[top]
Segment boundaries for domain 1mk4A00

Chopping figure for domain 1mk4A00
DomainStart PDB ResidueStop PDB Residue
1mk4A00 0 156

Structural Neighbourhood (54 entries)

There are 54 matching structural neighberhood comparisons for CATH ID 3.40.630.30.7.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 54 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2r7hB00 86.42 Desulfovibrio desulfuricans subsp. desulfuricans str. G20Putative uncharacterized protein 3.40.630.30 157 13 93 2.87 3.07
3d3sA00 85.89 L-2,4-diaminobutyric acid acetyltransferaseGlycine, serine and threonine metabolismBordetella parapertussisL-2,4-diaminobutyric acid acetyltransferase [EC:2.3.1.178]Metabolic pathways 3.40.630.30 157 15 91 2.67 2.93
3k9uA00 85.74 Putative uncharacterized protein Ta0374Thermoplasma acidophilum 3.40.630.30 159 16 86 2.22 2.56
2fiaA00 85.67 Acetyltransferase, GNAT familyEnterococcus faecalis 3.40.630.30 157 12 91 2.68 2.92
3g8wA00 85.65 Staphylococcus epidermidis ATCC 12228Lactococcal prophage ps3 protein 05 3.40.630.30 158 10 91 2.77 3.04
1tiqB00 85.02 Bacillus subtilisProtease synthase and sporulation negative regulatory protein PAI 1 3.40.630.30 161 14 88 2.39 2.71
2i79D00 84.83 Acetyltransferase, GNAT familyStreptococcus pneumoniae 3.40.630.30 167 15 88 3.27 3.71
2fiwA00 84.77 Putative acetyltransferase [EC:2.3.1.-]GCN5-related N-acetyltransferase:Aminotransferase, class-IIRhodopseudomonas palustris 3.40.630.30 156 11 84 2.50 2.95
2ge3B00 84.74 Agrobacterium tumefaciens str. C58Probable acetyltransferase 3.40.630.30 159 15 90 3.26 3.60
1s3zA00 84.56 Salmonella enterica subsp. enterica serovar EnteritidisAminoglycoside 6'-N-acetyltransferase 3.40.630.30 147 20 85 3.55 4.16
3fncA00 84.22 Listeria innocuaLin0611 protein 3.40.630.30 157 13 89 2.66 2.98
1cjwA00 84.17 Ovis ariesSerotonin N-acetyltransferase 3.40.630.30 166 14 86 2.75 3.17
1vhsB00 83.90 Bacillus subtilisPhosphinothricin acetyltransferase [EC:2.3.1.183]Phosphonate and phosphinate metabolismPutative phosphinothricin acetyltransferase ywnH 3.40.630.30 155 12 92 3.42 3.70
1gheA00 83.72 Tyrosine metabolismLimonene and pinene degradationAcetyltransferase1- and 2-Methylnaphthalene degradationPhenylalanine metabolism 3.40.630.30 166 13 86 3.18 3.67
1qsmD00 83.13 CytoplasmIdentical protein bindingSaccharomyces cerevisiaeHistone acetyltransferase activityHistone acetyltransferase HPA2 3.40.630.30 152 14 86 3.12 3.60
3exnA00 82.91 Tyrosine metabolismLimonene and pinene degradation1- and 2-Methylnaphthalene degradationPhenylalanine metabolismBenzoate degradation via CoA ligation 3.40.630.30 151 13 88 3.00 3.39
2pdoA01 82.43 Shigella flexneriAcetyltransferase ypeA 3.40.630.30 118 21 75 2.85 3.79
1n71B00 82.24 Aac(6')-Ii proteinEnterococcus faecium 3.40.630.30 179 17 78 2.53 3.21
3efaA00 82.11 Tyrosine metabolismBenzoate degradation via CoA ligationLactobacillus plantarumAcetyltransferase (Putative)Limonene and pinene degradation 3.40.630.30 141 11 86 2.93 3.38
1q2yA00 81.71 Bacillus subtilisUncharacterized N-acetyltransferase yjcF 3.40.630.30 140 8 85 3.63 4.22
2i00C01 81.39 Acetyltransferase, GNAT familyEnterococcus faecalis 3.40.630.30 144 10 80 2.93 3.65
2hqyA02 81.08 Hypothetical proteinBacteroides thetaiotaomicronPutative uncharacterized protein 3.40.630.30 164 10 73 2.40 3.25
2ozgA01 80.89 Anabaena variabilis ATCC 29413GCN5-related N-acetyltransferase 3.40.630.30 117 10 73 3.21 4.34
2dxqA00 80.70 Agrobacterium tumefaciens str. C58Acetyltransferase 3.40.630.30 145 13 85 3.47 4.07
1sqhA02 80.68 Drosophila melanogasterCG14615 3.40.630.30 128 10 69 2.53 3.64
3eo4A00 80.49 Methanocaldococcus jannaschiiUncharacterized protein MJ1062 3.40.630.30 155 12 84 3.15 3.72
1bo4A00 80.34 Aminoglycoside-(3)-N-acetyltransferaseSerratia marcescens 3.40.630.30 136 7 78 3.47 4.43
1yreC00 80.31 Pseudomonas aeruginosaPutative uncharacterized protein 3.40.630.30 182 10 81 3.11 3.82
1y9wA01 80.28 AcetyltransferaseBacillus cereus ATCC 14579 3.40.630.30 104 17 65 3.12 4.76
1ufhA00 80.24 Uncharacterized N-acetyltransferase yycNBacillus subtilis 3.40.630.30 155 9 82 4.08 4.93
2atrA00 79.92 Acetyltransferase, GNAT familyStreptococcus pneumoniae 3.40.630.30 127 12 80 3.59 4.47
2r1iA01 79.90 Arthrobacter sp. FB24GCN5-related N-acetyltransferase 3.40.630.30 129 10 73 2.94 3.98
2pr1A00 79.88 Uncharacterized N-acetyltransferase ylbPBacillus subtilis 3.40.630.30 152 7 80 3.96 4.90
2qecA00 79.81 Corynebacterium glutamicumGCN5-related N-acetyltransferase 3.40.630.30 175 10 76 3.38 4.41
1xebA00 79.79 Pseudomonas aeruginosaElaA proteinPutative uncharacterized protein 3.40.630.30 146 11 87 3.66 4.19
3f5bA00 79.72 Aminoglycoside N(6')acetyltransferaseLegionella pneumophila subsp. pneumophila str. Philadelphia 1 3.40.630.30 163 12 84 3.62 4.28
1u6mA00 79.54 Acetyltransferase, GNAT familyEnterococcus faecalis 3.40.630.30 188 15 73 3.33 4.50
2fckA00 79.53 Vibrio choleraeRibosomal-protein-serine acetyltransferase, putative 3.40.630.30 171 12 84 3.36 3.96
3fbuA00 79.43 Bacillus anthracisAcetyltransferase, GNAT family 3.40.630.30 166 10 86 3.75 4.32
1y9kA01 79.41 Tyrosine metabolismLimonene and pinene degradationIAA acetyltransferaseBacillus cereus ATCC 145791- and 2-Methylnaphthalene degradation 3.40.630.30 110 20 70 3.47 4.95
2q0yA01 79.13 Ralstonia eutropha JMP134GCN5-related N-acetyltransferase 3.40.630.30 125 12 70 3.53 4.99
1lrzA01 78.98 Peptidoglycan biosynthesisMetabolic pathwaysPeptidoglycan pentaglycine glycine transferase (the second and third glycine) [EC:2.3.2.-]Aminoacyltransferase femAStaphylococcus aureus 3.40.630.30 143 10 76 3.21 4.20
3gkrA02 78.85 Weissella viridescensFemX 3.40.630.30 165 4 74 2.81 3.77
2fl4A02 78.53 Arginine and proline metabolismSpermine/spermidine acetyltransferase, putativeDiamine N-acetyltransferase [EC:2.3.1.57]Metabolic pathwaysEnterococcus faecalis 3.40.630.30 104 11 64 2.52 3.88
1ro5A01 78.05 Pseudomonas aeruginosaAcyl homoserine lactone synthase [EC:2.3.1.184]Acyl-homoserine-lactone synthase 3.40.630.30 187 7 75 3.74 4.93
1nslA00 77.68 Bacillus subtilisPutative ribosomal N-acetyltransferase ydaF 3.40.630.30 173 15 82 3.86 4.70
2hv2A03 77.16 Enterococcus faecalisPutative uncharacterized protein 3.40.630.30 148 8 76 3.43 4.49
3ey5A01 77.05 Acetyltransferase-like, GNAT familyBacteroides thetaiotaomicron 3.40.630.30 144 15 74 3.32 4.46
1iykA01 76.87 Glycylpeptide N-tetradecanoyltransferaseCandida albicans 3.40.630.30 147 7 64 2.59 3.99
1y7rA00 76.62 Staphylococcus aureus subsp. aureus Mu50Putative uncharacterized protein 3.40.630.30 125 8 74 3.58 4.80
1bobA02 76.54 Chromatin silencing at telomereHistone acetyltransferase 1 [EC:2.3.1.48]Histone acetyltransferase type B catalytic subunitHistone acetyltransferase activityProtein binding 3.40.630.30 124 9 63 2.94 4.62
2qmlA00 75.95 BH2621 proteinBacillus halodurans 3.40.630.30 184 10 75 3.50 4.63
1rxtC01 75.41 Glycylpeptide N-tetradecanoyltransferase [EC:2.3.1.97]Protein lipoylationHomo sapiensGlycylpeptide N-tetradecanoyltransferase 1 3.40.630.30 132 10 71 3.40 4.72
2hqyA01 73.81 Hypothetical proteinBacteroides thetaiotaomicronPutative uncharacterized protein 3.40.630.30 130 10 74 3.60 4.83
[1]
Displaying entries 1 to 54 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1mk4A00
HMDIRTITSSDYEMVTSVLNEWWGGRQLKEKLPRLFFEHFQDTSFITSEHNSMTGFLIGFQSQSDPETAYIHFSGVHPDF
RKMQIGKQLYDVFIETVKQRGCTRVKCVTSPVNKVSIAYHTKLGFDIEKGTKTVNGISVFANYDGPGQDRVLFVKNI
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1mk4A00
HMDIRTITSSDYEMVTSVLNEWWGGRQLKEKLPRLFFEHFQDTSFITSEHNSMTGFLIGFQSQSDPETAYIHFSGVHPDF
RKMQIGKQLYDVFIETVKQRGCTRVKCVTSPVNKVSIAYHTKLGFDIEKGTKTVNGISVFANYDGPGQDRVLFVKNI
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:27

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:27

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:49

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"