Set cath from cathlist by auto on 05 Mar 2006 18:02
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1mgtA01 | 1 | 88 |
| 1mgtA02 | 89 | 169 |
There are 18 matching structural neighberhood comparisons for CATH ID 1.10.10.10.11.1.1.1.1 (SIMAX score < 5)
>pdb|1mgtA02 VTPFEKKVYEWLTKNVKRGSVITYGDLAKALNTSPRAVGGAMKRNPYPIVVPCHRVVAHDGIGYYSSGIEEKKFLLEIEG V
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"