CATH Domain: 1mdyA00 XML data for domain: 1mdyA00

Molscript image for 1mdyA00
1mdyA00
PDB coordinates for domain 1mdyA00

PDB 1mdy, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
4 Few Secondary Structures
4.10 Irregular
4.10.280 MYOD Basic-Helix-Loop-Helix Domain, subunit B
4.10.280.10 MYOD Basic-Helix-Loop-Helix Domain, subunit B Gene3D
4.10.280.10.4
4.10.280.10.4.1
4.10.280.10.4.1.1
4.10.280.10.4.1.1.1
4.10.280.10.4.1.1.1.1

[top]
Segment boundaries for domain 1mdyA00

Chopping figure for domain 1mdyA00
DomainStart PDB ResidueStop PDB Residue
1mdyA00 1 166

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 4.10.280.10.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2ql2C00 88.75 Positive regulation of transcription from RNA polymerase II promoterResponse to lipopolysaccharideImmunoglobulin V(D)J recombinationHistone H3 acetylationTranscription factor complex 4.10.280.10 58 36 83 2.74 3.27
1a0aA00 80.25 Positive regulation of transcription from RNA polymerase II promoterChromatin remodelingNucleusPositive regulation of phosphate metabolic processPhosphate system positive regulatory protein PHO4 4.10.280.10 63 20 85 3.96 4.64
1m56D00 79.36 Rhodobacter sphaeroidesAa3-type cytochrome c oxidase subunit IV 1.20.5.160 42 11 58 2.00 3.40
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1mdyA00
MELKRKTTNADRRKAATMRERRRLSKVNEAFETLKRSTSSNPNQRLPKVEILRNAIRYIEGLQALLRD
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1mdyA00
MELKRKTTNADRRKAATMRERRRLSKVNEAFETLKRSTSSNPNQRLPKVEILRNAIRYIEGLQALLRD
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:38

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:38

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:01

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"