CATH Domain: 1mdlA01 XML data for domain: 1mdlA01

Molscript image for 1mdlA01
1mdlA01
PDB coordinates for domain 1mdlA01

PDB 1mdl, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.390 Enolase-like; domain 1
3.30.390.10 Enolase-like, N-terminal domain Gene3D
3.30.390.10.10
3.30.390.10.10.1
3.30.390.10.10.1.1
3.30.390.10.10.1.1.1
3.30.390.10.10.1.1.1.1

[top]
Segment boundaries for domain 1mdlA01

Chopping figure for domain 1mdlA01
DomainStart PDB ResidueStop PDB Residue
1mdlA01 3 120
1mdlA01 351 358
1mdlA02 121 350

Structural Neighbourhood (20 entries)

There are 20 matching structural neighberhood comparisons for CATH ID 3.30.390.10.10.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 20 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3go2A01 89.04 Burkholderia xenovorans LB400Putative uncharacterized protein 3.30.390.10 114 15 86 1.82 2.10
2ovlA01 88.80 Toluene and xylene degradationStreptomyces coelicolorMandelate racemase [EC:5.1.2.2]Benzoate degradation via hydroxylationPutative racemase 3.30.390.10 123 18 96 2.16 2.25
3bjsA01 88.09 Polaromonas sp. JS666Mandelate racemase/muconate lactonizing enzyme 3.30.390.10 116 21 89 2.20 2.45
2oqhB01 87.72 Putative isomeraseStreptomyces coelicolor 3.30.390.10 129 21 88 3.12 3.53
1nu5A01 87.61 Chloromuconate cycloisomerasePseudomonas sp. P51 3.30.390.10 116 18 86 1.93 2.23
2qq6B01 86.81 Rubrobacter xylanophilus DSM 9941Mandelate racemase/muconate lactonizing enzyme-like protein 3.30.390.10 115 17 80 1.54 1.90
3fv9D01 86.08 Mandelate racemase/muconate lactonizing enzyme, putativeRoseovarius nubinhibens ISM 3.30.390.10 130 13 91 2.68 2.93
1tkkA01 86.08 Bacillus subtilisL-Ala-D/L-Glu epimerase 3.30.390.10 115 20 87 2.73 3.13
1ec7C01 86.08 Ascorbate and aldarate metabolismD-glucarate catabolic processGlucarate dehydratase activityGlucarate dehydrataseGlucarate dehydratase [EC:4.2.1.40] 3.30.390.10 136 12 85 2.19 2.57
1tzzB01 84.85 Bradyrhizobium japonicumBll6730 protein 3.30.390.10 119 21 80 2.66 3.29
2oqyA01 84.83 Muconate cycloisomeraseOceanobacillus iheyensis 3.30.390.10 142 19 80 2.54 3.16
2qgyB01 84.70 3.30.390.10 135 16 86 2.37 2.73
2pgwA01 84.70 Sinorhizobium melilotiToluene and xylene degradationBenzoate degradation via hydroxylationMuconate cycloisomerase [EC:5.5.1.1]Mandelate racemase/muconate lactonizing enzyme family protein 3.30.390.10 147 21 82 1.88 2.28
2qjjA01 84.62 Mandelate racemase/muconate lactonizing enzyme, N-terminal domain proteinStarvation sensing protein RspANovosphingobium aromaticivorans DSM 12444 3.30.390.10 140 17 77 1.52 1.97
1rvkA01 84.39 Agrobacterium tumefaciens str. C58Isomerase/lactonizing enzyme 3.30.390.10 115 17 86 3.28 3.79
2zadA01 84.20 Thermotoga maritimaL-Ala-D/L-Glu epimerase 3.30.390.10 109 12 83 2.48 2.98
2hzgB01 84.03 Rhodobacter sphaeroides 2.4.1Mandelate racemase/muconate lactonizing enzyme/Enolase superfamily 3.30.390.10 143 16 79 3.06 3.87
2oz8A01 82.98 Mesorhizobium lotiMll7089 protein 3.30.390.10 128 10 88 3.09 3.50
1jpdX01 82.82 Racemase and epimerase activity, acting on amino acids and derivativesL-Ala-D/L-Glu epimeraseEscherichia coli K-12 3.30.390.10 99 17 76 2.98 3.87
2nqlA01 81.51 Agrobacterium tumefaciens str. C58Isomerase/lactonizing enzyme 3.30.390.10 162 19 73 3.32 4.52
[1]
Displaying entries 1 to 20 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1mdlA01
EVLITGLRTRAVNVPLAYPVHTAVGTVGTAPLVLIDLATSAGVVGHSYLFAYTPVALKSLKQLLDDMAAMIVNEPLAPVS
LEAMLAKRFCLAGYTGLIRMAAAGIDMAAWDALGKVHEEKEIGKYL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1mdlA01
MSEVLITGLRTRAVNVPLAYPVHTAVGTVGTAPLVLIDLATSAGVVGHSYLFAYTPVALKSLKQLLDDMAAMIVNEPLAP
VSLEAMLAKRFCLAGYTGLIRMAAAGIDMAAWDALGKVHEEKEIGKYL
BLAST against CATH

[top]
Domain History Events (3)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1mdl001" to "1mdlA01" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Insertion by lewis on 18 Jan 2007 19:49

Rechopping chains just before release v3.1.0 in order to fix missing fragments.

Domain assigned by lewis on 18 Jan 2007 19:49

Reassigning this domain to its previous classification as part of fragment fixing process in preparation for release v3.1.0.