CATH Domain: 1mdbA04 XML data for domain: 1mdbA04

Molscript image for 1mdbA04
1mdbA04
PDB coordinates for domain 1mdbA04

PDB 1mdb, Chain A, Domain 4

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.300 GMP Synthetase; Chain A, domain 3
3.30.300.30 Gene3D
3.30.300.30.4
3.30.300.30.4.1
3.30.300.30.4.1.1
3.30.300.30.4.1.1.1
3.30.300.30.4.1.1.1.1

[top]
Segment boundaries for domain 1mdbA04

Chopping figure for domain 1mdbA04
DomainStart PDB ResidueStop PDB Residue
1mdbA01 22 179
1mdbA02 180 353
1mdbA03 354 429
1mdbA04 430 536

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.30.300.30.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1t5hX04 90.97 4-chlorobenzoyl CoA ligaseAlcaligenes sp. AL3007 3.30.300.30 101 29 93 1.28 1.37
1lciA04 90.36 Photinus pyralisLuciferin 4-monooxygenasePeroxisome 3.30.300.30 99 25 90 1.58 1.74
1amuA04 87.93 Aneurinibacillus migulanusGramicidin S synthase 1 3.30.300.30 96 27 89 2.13 2.37
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1mdbA04
KDQINRGGEKVAAEEVENHLLAHPAVHDAAMVSMPDQFLGERSCVFIIPRDEAPKAAELKAFLRERGLAAYKIPDRVEFV
ESFPQTGVGKVSKKALREAISEKLLAG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1mdbA04
KDQINRGGEKVAAEEVENHLLAHPAVHDAAMVSMPDQFLGERSCVFIIPRDEAPKAAELKAFLRERGLAAYKIPDRVEFV
ESFPQTGVGKVSKKALREAISEKLLAGFKK
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:03

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:03

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:14

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"