Set cath from cathlist by auto on 05 Mar 2006 18:25
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1m93B01 | 56 | 132 |
| 1m93B01 | 241 | 283 |
| 1m93B01 | 294 | 300 |
| 1m93B02 | 133 | 240 |
| 1m93B02 | 284 | 293 |
There are 12 matching structural neighberhood comparisons for CATH ID 2.30.39.10.4.1.1.1.1 (SIMAX score < 5)
>pdb|1m93B02 FKAKWLMPFEKEFTSDYPFYVSPTEMVDVSMMSMYGEAFNHASVKESFGNFSIIELPYVGDTSMVVILPDNIDGLESIEQ NLTDTNFKKWSDSMDAMFIDVHIPKFKVIDVNEEYTEA
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"