CATH Domain: 1m93B01 XML data for domain: 1m93B01

Molscript image for 1m93B01
1m93B01
PDB coordinates for domain 1m93B01

PDB 1m93, Chain B, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.497 Antithrombin; Chain I, domain 2
3.30.497.10 Antithrombin, subunit I, domain 2 Gene3D
3.30.497.10.11
3.30.497.10.11.1
3.30.497.10.11.1.1
3.30.497.10.11.1.1.1
3.30.497.10.11.1.1.1.1

[top]
Segment boundaries for domain 1m93B01

Chopping figure for domain 1m93B01
DomainStart PDB ResidueStop PDB Residue
1m93B01 56 132
1m93B01 241 283
1m93B01 294 300
1m93B02 133 240
1m93B02 284 293

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.30.497.10.11.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1f0cA01 91.66 Serine proteinase inhibitor 2Cowpox virus (Brighton Red) 3.30.497.10 161 96 78 0.56 0.71
1jjoC01 83.53 Mus musculusNeuroserpin 3.30.497.10 149 25 74 1.88 2.52
1imvA02 74.63 Negative regulation of angiogenesisHomo sapiensPigment epithelium-derived factorPositive regulation of neurogenesisCell proliferation 3.30.497.10 206 14 57 2.78 4.85
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1m93B01
DISFKSMNKVYGRYSAVFKDSFLRKIGDNFQTVDFTDSRTVDAINKSVDIFTEGKINPLLDEPLSPDTSLLAISAVYTGS
YNLVDALVKLGLTEVFGSTGDYSNMSNSDVSVDAMIHKTYAAATSAL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1m93B01
DISFKSMNKVYGRYSAVFKDSFLRKIGDNFQTVDFTDSRTVDAINKSVDIFTEGKINPLLDEPLSPDTSLLAISAVYTGS
YNLVDALVKLGLTEVFGSTGDYSNMSNSDVSVDAMIHKTYAAATSAL
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:06

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:06

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:13

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"