CATH Domain: 1m6iA03 XML data for domain: 1m6iA03

Molscript image for 1m6iA03
1m6iA03
PDB coordinates for domain 1m6iA03

PDB 1m6i, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.390 Enolase-like; domain 1
3.30.390.30 Gene3D
3.30.390.30.4
3.30.390.30.4.1
3.30.390.30.4.1.1
3.30.390.30.4.1.1.1
3.30.390.30.4.1.1.1.1

[top]
Segment boundaries for domain 1m6iA03

Chopping figure for domain 1m6iA03
DomainStart PDB ResidueStop PDB Residue
1m6iA01 129 169
1m6iA01 212 261
1m6iA01 403 476
1m6iA02 172 204
1m6iA02 265 397
1m6iA03 481 608

Structural Neighbourhood (6 entries)

There are 6 matching structural neighberhood comparisons for CATH ID 3.30.390.30.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 6 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2gqwA03 80.92 Ferredoxin reductasePseudomonas sp. KKS102 3.30.390.30 89 16 74 3.21 4.33
1q1rA03 80.84 Putidaredoxin reductasePseudomonas putida 3.30.390.30 95 18 73 2.97 4.06
1nhpA03 77.63 NADH peroxidaseNADH peroxidase [EC:1.11.1.1]Enterococcus faecalis 3.30.390.30 113 8 65 3.06 4.67
1xdiA03 76.49 Citrate cycle (TCA cycle)Valine, leucine and isoleucine degradationPyruvate metabolismGlycine, serine and threonine metabolismMetabolic pathways 3.30.390.30 122 10 66 3.27 4.93
2a8xA03 76.14 Citrate cycle (TCA cycle)Pyruvate metabolismValine, leucine and isoleucine degradationGlycine, serine and threonine metabolismMetabolic pathways 3.30.390.30 119 7 68 3.16 4.64
1xhcA03 73.39 Pyrococcus furiosusNADH oxidase /nitrite reductase 3.30.390.30 48 12 44 1.63 3.67
[1]
Displaying entries 1 to 6 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1m6iA03
MFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASYGKGVIFYLRDKVVVGIVLWN
IFNRMPIARKIIKDGEQHEDLNEVAKLF
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1m6iA03
MFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSTPAVPQAPVQGEDY
GKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 18:10

Assigning to "3.30.390.30" based on similarity with "1gv4B03" (NWSI: 96.9465648854962, NWO: 98.4962406015038, SPS: 93.92, SPO: 82, RMSD: 0.36)

Flow stage update by auto on 28 Apr 2006 17:49

NW result present for Domain "1m6iA03"

Flow stage update by auto on 28 Apr 2006 17:43

All required files are present for Domain "1m6iA03"

Flow stage update by auto on 27 Apr 2006 17:30

Beginning processing for Domain "1m6iA03"

Insertion by auto on 05 Mar 2006 17:13

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"