CATH Domain: 1m4rB00 XML data for domain: 1m4rB00

Molscript image for 1m4rB00
1m4rB00
PDB coordinates for domain 1m4rB00

PDB 1m4r, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1250 Growth Hormone; Chain: A;
1.20.1250.10 Gene3D
1.20.1250.10.3
1.20.1250.10.3.1
1.20.1250.10.3.1.1
1.20.1250.10.3.1.1.2
1.20.1250.10.3.1.1.2.1

[top]
Segment boundaries for domain 1m4rB00

Chopping figure for domain 1m4rB00
DomainStart PDB ResidueStop PDB Residue
1m4rB00 39 179

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 1.20.1250.10.3.1.1.2.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1n1fA00 83.13 Jak-STAT signaling pathwayCytokine-cytokine receptor interactionCytokine activityInterleukin 19/20/24Homo sapiens 1.20.1250.10 153 14 84 2.42 2.85
1lqsL02 66.86 Viral interleukin-10 homologHuman herpesvirus 5 strain AD169 4.10.340.10 42 21 30 1.38 4.52
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1m4rB00
HCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEV
VPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1m4rB00
QGGAAAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQS
DRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:20

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:20

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 14:42

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"