CATH Domain: 1m4lA00 XML data for domain: 1m4lA00

Molscript image for 1m4lA00
1m4lA00
PDB coordinates for domain 1m4lA00

PDB 1m4l, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.630 Aminopeptidase
3.40.630.10 Zn peptidases Gene3D
3.40.630.10.3
3.40.630.10.3.1
3.40.630.10.3.1.1
3.40.630.10.3.1.1.1
3.40.630.10.3.1.1.1.1

[top]
Segment boundaries for domain 1m4lA00

Chopping figure for domain 1m4lA00
DomainStart PDB ResidueStop PDB Residue
1m4lA00 1 307

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.40.630.10.3.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1jqgA02 90.25 Carboxypeptidase AHelicoverpa armigera 3.40.630.10 309 29 94 1.59 1.68
1obrA00 89.00 Carboxypeptidase TThermoactinomyces vulgaris 3.40.630.10 323 29 91 2.86 3.11
1h8lA01 84.54 Zinc ion bindingLophonetta specularoidesCarboxypeptidase D 3.40.630.10 301 18 89 3.35 3.73
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1m4lA00
ARSTNTFNYATYHTLDEIYDFMDLLVAEHPQLVSKLQIGRSYEGRPIYVLKFSTGGSNRPAIWIDLGIHSREWITQATGV
WFAKKFTEDYGQDPSFTAILDSMDIFLEIVTNPDGFAFTHSQNRLWRKTRSVTSSSLCVGVDANRNWDAGFGKAGASSSP
CSETYHGKYANSEVEVKSIVDFVKDHGNFKAFLSIHSYSQLLLYPYGYTTQSIPDKTELNQVAKSAVAALKSLYGTSYKY
GSIITTIYQASGGSIDWSYNQGIKYSFTFELRDTGRYGFLLPASQIIPTAQETWLGVLTIMEHTVNN
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1m4lA00
ARSTNTFNYATYHTLDEIYDFMDLLVAEHPQLVSKLQIGRSYEGRPIYVLKFSTGGSNRPAIWIDLGIHSREWITQATGV
WFAKKFTEDYGQDPSFTAILDSMDIFLEIVTNPDGFAFTHSQNRLWRKTRSVTSSSLCVGVDANRNWDAGFGKAGASSSP
CSETYHGKYANSEVEVKSIVDFVKDHGNFKAFLSIHSYSQLLLYPYGYTTQSIPDKTELNQVAKSAVAALKSLYGTSYKY
GSIITTIYQASGGSIDWSYNQGIKYSFTFELRDTGRYGFLLPASQIIPTAQETWLGVLTIMEHTVNN
BLAST against CATH

[top]
Domain History Events (23)

Domain assigned by auto on 21 Oct 2008 18:11

Assigning to "3.40.630.10" based on similarity with "2rfhA00"

Flow stage update by auto on 21 Oct 2008 18:09

No in_process hits for Domain "1m4lA00" ready to be processed

Update comment by auto on 21 Oct 2008 18:07

Domain "1m4lA00" hits Domain "1hdqA00" (99.3485342019544% over 100%) which is currently in process

Update comment by auto on 21 Oct 2008 18:05

Domain "1m4lA00" hits Domain "1heeD00" (97.7198697068404% over 100%) which is currently in process

Update comment by auto on 21 Oct 2008 18:03

Domain "1m4lA00" hits Domain "1heeA00" (97.7198697068404% over 100%) which is currently in process

Update comment by auto on 21 Oct 2008 18:01

Domain "1m4lA00" hits Domain "1hduA00" (97.7198697068404% over 100%) which is currently in process

Update comment by auto on 21 Oct 2008 17:58

Domain "1m4lA00" hits Domain "1hduB00" (97.7198697068404% over 100%) which is currently in process

Update comment by auto on 21 Oct 2008 17:55

Domain "1m4lA00" hits Domain "1hduE00" (97.7198697068404% over 100%) which is currently in process

Update comment by auto on 21 Oct 2008 17:52

Domain "1m4lA00" hits Domain "1hduD00" (97.7198697068404% over 100%) which is currently in process

Update comment by auto on 21 Oct 2008 17:50

Domain "1m4lA00" hits Domain "1heeE00" (97.7198697068404% over 100%) which is currently in process

Update comment by auto on 21 Oct 2008 17:48

Domain "1m4lA00" hits Domain "1heeB00" (97.7198697068404% over 100%) which is currently in process

Update comment by auto on 21 Oct 2008 17:46

Domain "1m4lA00" hits Domain "1f57A00" (100% over 100%) which is currently in process

Update comment by auto on 21 Oct 2008 17:44

Domain "1m4lA00" hits Domain "1elmP00" (100% over 99.3527508090615%) which is currently in process

Update comment by auto on 21 Oct 2008 17:42

Domain "1m4lA00" hits Domain "1ellP00" (100% over 99.3527508090615%) which is currently in process

Update comment by auto on 21 Oct 2008 17:35

Domain "1m4lA00" hits Domain "1ee3P00" (100% over 99.3527508090615%) which is currently in process

Update comment by auto on 21 Oct 2008 17:29

Domain "1m4lA00" hits Domain "1cpxA00" (100% over 100%) which is currently in process

Update comment by auto on 21 Oct 2008 17:12

Domain "1m4lA00" hits Domain "1nsaA02" (48.1848184818482% over 98.0456026058632%) which is currently in process

Update comment by auto on 21 Oct 2008 14:12

Domain "1m4lA00" hits Domain "2rfhA00" (100% over 100%) which is currently in process

Flow stage update by auto on 21 Oct 2008 14:07

Domain "1m4lA00" hits Domain "2rfhA00" (100% over 100%) which is currently in process

Flow stage update by auto on 21 Oct 2008 14:07

NW result present for Domain "1m4lA00"

Flow stage update by auto on 21 Oct 2008 08:34

All required files are present for Domain "1m4lA00"

Flow stage update by auto on 20 Oct 2008 18:49

Beginning processing for Domain "1m4lA00"

Insertion by auto on 20 Oct 2008 17:58

Final ChopClose added based on similarity with "1arlA"