CATH Domain: 1m4iB00 XML data for domain: 1m4iB00

Molscript image for 1m4iB00
1m4iB00
PDB coordinates for domain 1m4iB00

PDB 1m4i, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.630 Aminopeptidase
3.40.630.30 Gene3D
3.40.630.30.17
3.40.630.30.17.1
3.40.630.30.17.1.1
3.40.630.30.17.1.1.1
3.40.630.30.17.1.1.1.1

Segment boundaries for domain 1m4iB00

Chopping figure for domain 1m4iB00
DomainStart PDB ResidueStop PDB Residue
1m4iB00 6 181

Structural Neighbourhood (25 entries)

There are 25 matching structural neighberhood comparisons for CATH ID 3.40.630.30.17.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 25 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1xebA00 82.83 Pseudomonas aeruginosaElaA proteinPutative uncharacterized protein 3.40.630.30 146 16 72 2.15 2.96
2i00C01 82.24 Acetyltransferase, GNAT familyEnterococcus faecalis 3.40.630.30 144 15 72 2.09 2.87
1q2yA00 82.05 Bacillus subtilisUncharacterized N-acetyltransferase yjcF 3.40.630.30 140 11 73 2.76 3.74
2q7bA00 81.94 Acetyltransferase, GNAT familyStreptococcus agalactiae serogroup V 3.40.630.30 161 11 79 3.32 4.17
3d8pB00 81.86 Staphylococcus aureus subsp. aureus Mu50Putative uncharacterized protein 3.40.630.30 157 10 78 3.65 4.62
1n71B00 81.86 Aac(6')-Ii proteinEnterococcus faecium 3.40.630.30 179 6 78 3.01 3.85
2i79D00 80.36 Acetyltransferase, GNAT familyStreptococcus pneumoniae 3.40.630.30 167 10 77 3.79 4.90
3k9uA00 80.32 Putative uncharacterized protein Ta0374Thermoplasma acidophilum 3.40.630.30 159 8 73 3.01 4.11
2qecA00 80.02 Corynebacterium glutamicumGCN5-related N-acetyltransferase 3.40.630.30 175 15 78 3.83 4.85
1s3zA00 79.94 Salmonella enterica subsp. enterica serovar EnteritidisAminoglycoside 6'-N-acetyltransferase 3.40.630.30 147 11 75 3.57 4.72
2ge3B00 79.65 Agrobacterium tumefaciens str. C58Probable acetyltransferase 3.40.630.30 159 11 75 3.23 4.31
3efaA00 79.49 Tyrosine metabolismBenzoate degradation via CoA ligationLactobacillus plantarumAcetyltransferase (Putative)Limonene and pinene degradation 3.40.630.30 141 14 76 3.25 4.24
3e0kA00 79.46 Arginine and proline metabolismVibrio parahaemolyticusAmino-acid N-acetyltransferase [EC:2.3.1.1]Amino-acid acetyltransferaseMetabolic pathways 3.40.630.30 143 13 72 3.40 4.67
2ozgA01 79.36 Anabaena variabilis ATCC 29413GCN5-related N-acetyltransferase 3.40.630.30 117 15 64 2.62 4.08
2pdoA01 79.32 Shigella flexneriAcetyltransferase ypeA 3.40.630.30 118 11 61 2.39 3.86
2pr1A00 79.31 Uncharacterized N-acetyltransferase ylbPBacillus subtilis 3.40.630.30 152 7 75 3.60 4.76
3g8wA00 79.05 Staphylococcus epidermidis ATCC 12228Lactococcal prophage ps3 protein 05 3.40.630.30 158 8 76 3.31 4.35
3exnA00 78.75 Tyrosine metabolismLimonene and pinene degradation1- and 2-Methylnaphthalene degradationPhenylalanine metabolismBenzoate degradation via CoA ligation 3.40.630.30 151 11 75 3.45 4.57
1iykA01 77.65 Glycylpeptide N-tetradecanoyltransferaseCandida albicans 3.40.630.30 147 6 60 2.47 4.10
1y9wA01 77.26 AcetyltransferaseBacillus cereus ATCC 14579 3.40.630.30 104 13 53 2.46 4.56
1rxtC01 76.72 Glycylpeptide N-tetradecanoyltransferase [EC:2.3.1.97]Protein lipoylationHomo sapiensGlycylpeptide N-tetradecanoyltransferase 1 3.40.630.30 132 6 66 3.07 4.62
2fl4A02 75.15 Arginine and proline metabolismSpermine/spermidine acetyltransferase, putativeDiamine N-acetyltransferase [EC:2.3.1.57]Metabolic pathwaysEnterococcus faecalis 3.40.630.30 104 15 56 2.75 4.89
1sqhA02 74.85 Drosophila melanogasterCG14615 3.40.630.30 128 11 57 2.77 4.78
2hqyA02 74.72 Hypothetical proteinBacteroides thetaiotaomicronPutative uncharacterized protein 3.40.630.30 164 7 64 2.67 4.16
1lrzA02 73.96 Peptidoglycan biosynthesisMetabolic pathwaysPeptidoglycan pentaglycine glycine transferase (the second and third glycine) [EC:2.3.2.-]Aminoacyltransferase femAStaphylococcus aureus 3.40.630.30 195 4 55 2.70 4.83
Displaying entries 1 to 25 (page 1 of 1)


Domain ATOM Sequence

>pdb|1m4iB00
HTARLVHTADLDSETRQDIRQMVTGAFAGDFTETDWEHTLGGMHALIWHHGAIIAHAAVIQRRLIYRGNALRCGYVEGVA
VRADWRGQRLVSALLDAVEQVMRGAYQLGALSSSARARRLYASRGWLPWHGPTSVLAPTGPVRTPDDDGTVFVLPIDISL
DTSAELMCDWRAGDVW    

Domain COMBS Sequence

>pdb|1m4iB00
MHTQVHTARLVHTADLDSETRQDIRQMVTGAFAGDFTETDWEHTLGGMHALIWHHGAIIAHAAVIQRRLIYRGNALRCGY
VEGVAVRADWRGQRLVSALLDAVEQVMRGAYQLGALSSSARARRLYASRGWLPWHGPTSVLAPTGPVRTPDDDGTVFVLP
IDISLDTSAELMCDWRAGDVW    

Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:27

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:27

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:49

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"