Flow stage update by cuff on 25 Apr 2006 18:50
COMMENT: Sarah - Scores are quite good FINAL: Lesley - Yes, merge. Very good scores. Chopping looks fine. Move 1940 into 10940.
There are 3 matching structural neighberhood comparisons for CATH ID 3.40.50.10490.13.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1j5xA01 | 83.28 | 3.40.50.10490 | 155 | 14 | 81 | 3.74 | 4.57 | |
![]() |
1moqA02 | 81.24 | 3.40.50.10490 | 148 | 13 | 76 | 2.98 | 3.91 | |
![]() |
2q8nA02 | 76.27 | 3.40.50.10490 | 162 | 13 | 72 | 3.61 | 4.99 |
>pdb|1m3sB00 GMKTTEYVAEILNELHNSAAYISNEEADQLADHILSSHQIFTAGAGRSGLMAKSFAMRLMHMGFNAHIVGEILTPPLAEG DLVIIGSGSGETKSLIHTAAKAKSLHGIVAALTINPESSIGKQADLIIRMPGSPKDQSNGSYKTIQPMGSLFEQTLLLFY DAVILKLMEKKGLTMFTHHANLE
COMMENT: Sarah - Scores are quite good FINAL: Lesley - Yes, merge. Very good scores. Chopping looks fine. Move 1940 into 10940.
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"