CATH Domain: 1m3qA03 XML data for domain: 1m3qA03

Molscript image for 1m3qA03
1m3qA03
PDB coordinates for domain 1m3qA03

PDB 1m3q, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.340 Endonuclease III; domain 1
1.10.340.30 Hypothetical protein; domain 2 Gene3D
1.10.340.30.4
1.10.340.30.4.1
1.10.340.30.4.1.1
1.10.340.30.4.1.1.1
1.10.340.30.4.1.1.1.1

[top]
Segment boundaries for domain 1m3qA03

Chopping figure for domain 1m3qA03
DomainStart PDB ResidueStop PDB Residue
1m3qA01 9 100
1m3qA02 104 124
1m3qA02 265 323
1m3qA03 136 261

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 1.10.340.30.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1mpgA02 88.62 Base excision repairDNA dealkylation involved in DNA repairDNA-3-methyladenine glycosylase 2DNA-3-methyladenine glycosylase II [EC:3.2.2.21]Protein binding 1.10.340.30 118 27 91 2.04 2.24
1ornA01 85.96 1.10.340.30 112 17 79 1.90 2.39
1keaA02 84.18 G/T mismatches repair enzymeMethanothermobacter thermautotrophicus 1.10.340.30 113 18 79 2.13 2.68
1ngnA00 75.90 DNA damage response, signal transduction resulting in induction of apoptosisDNA methylationNucleusChromatinMus musculus 1.10.340.30 144 9 65 2.95 4.52
2ofkA00 74.68 Base excision repairDNA-3-methyladenine glycosylase I [EC:3.2.2.20]Salmonella enterica subsp. enterica serovar Typhi3-methyladenine DNA glycosylase I 1.10.340.30 182 13 62 3.03 4.88
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1m3qA03
DPIECLFSFICSSNNNIARITGMVERLCQAFGPRLIQLDDVTYHGFPSLQALAGPEVEAHLRKLGLGYRARYVSASARAI
LEEQGGLAWLQQLRESSYEEAHKALCILPGVGTKVADCICLMALDK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1m3qA03
DPIECLFSFICSSNNNIARITGMVERLCQAFGPRLIQLDDVTYHGFPSLQALAGPEVEAHLRKLGLGYRARYVSASARAI
LEEQGGLAWLQQLRESSYEEAHKALCILPGVGTKVADCICLMALDK
BLAST against CATH

[top]
Domain History Events (5)

Classification merge by cuff on 25 Apr 2006 18:16

COMMENT: Mark - Clearly a homology missed during Homcheck FINAL: Lesley - Yes, clearly related. Mark, why were these not picked up during homolcheck???Lesley - Conservatively, Merge 10 into 30 for now, until better HMM hits allow us to clearly bring it into 10. They have strong functional correlations but the HMM hits are no present to any previously existing members of 10. Only a new one going into 10 and that call now being reconsidered in light of these X-hits.

Flow stage update by cuff on 25 Apr 2006 18:16

COMMENT: Mark - Clearly a homology missed during Homcheck FINAL: Lesley - Yes, clearly related. Mark, why were these not picked up during homolcheck???Lesley - Conservatively, Merge 10 into 30 for now, until better HMM hits allow us to clearly bring it into 10. They have strong functional correlations but the HMM hits are no present to any previously existing members of 10. Only a new one going into 10 and that call now being reconsidered in light of these X-hits.

Set cath from cathlist by auto on 05 Mar 2006 18:08

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:08

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:12

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"