CATH Domain: 1m3qA02 XML data for domain: 1m3qA02

Molscript image for 1m3qA02
1m3qA02
PDB coordinates for domain 1m3qA02

PDB 1m3q, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.1670 Endonuclease Iii, domain 2
1.10.1670.10 Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) Gene3D
1.10.1670.10.1
1.10.1670.10.1.1
1.10.1670.10.1.1.1
1.10.1670.10.1.1.1.1
1.10.1670.10.1.1.1.1.1

[top]
Segment boundaries for domain 1m3qA02

Chopping figure for domain 1m3qA02
DomainStart PDB ResidueStop PDB Residue
1m3qA01 9 100
1m3qA02 104 124
1m3qA02 265 323
1m3qA03 136 261

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 1.10.1670.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3g0qA01 74.66 Geobacillus stearothermophilusA/G-specific adenine glycosylase 1.10.1670.10 110 8 58 2.86 4.92
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1m3qA02
VTLAQLYHHWGSVDSHFQEVAVPVEVHMWHIAQRDYSWHPTTSQAKGPSPQTNKELGNFFRSLWGPYAGWAQAVLFSADL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1m3qA02
VTLAQLYHHWGSVDSHFQEVAVPVEVHMWHIAQRDYSWHPTTSQAKGPSPQTNKELGNFFRSLWGPYAGWAQAVLFSADL
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:17

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:17

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:12

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"