CATH Domain: 1m32A01 XML data for domain: 1m32A01

Molscript image for 1m32A01
1m32A01
PDB coordinates for domain 1m32A01

PDB 1m32, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.90 Alpha-Beta Complex
3.90.1150 Aspartate Aminotransferase, domain 1
3.90.1150.10 Aspartate Aminotransferase, domain 1 Gene3D
3.90.1150.10.43
3.90.1150.10.43.1
3.90.1150.10.43.1.1
3.90.1150.10.43.1.1.1
3.90.1150.10.43.1.1.1.1

[top]
Segment boundaries for domain 1m32A01

Chopping figure for domain 1m32A01
DomainStart PDB ResidueStop PDB Residue
1m32A01 5 15
1m32A01 262 361
1m32A02 16 261

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 3.90.1150.10.43.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1uu2B01 82.90 Thermotoga maritimaTyrosine metabolismHistidinol-phosphate aminotransferase [EC:2.6.1.9]Histidine metabolismMetabolic pathways 3.90.1150.10 117 7 82 2.45 2.99
1svvB02 82.02 Leishmania major strain FriedlinThreonine aldolase [EC:4.1.2.5]Glycine, serine and threonine metabolismMetabolic pathwaysPutative uncharacterized protein 3.90.1150.10 88 10 77 3.25 4.21
1rv3A01 76.32 Oryctolagus cuniculusSerine hydroxymethyltransferase, cytosolic 3.90.1150.10 170 11 56 2.37 4.20
1tplA01 75.33 Citrobacter freundiiTyrosine phenol-lyase 3.90.1150.10 181 9 58 2.77 4.73
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1m32A01
YLLLTPGPLTTGGVAARHQRYQQNQRSLVAGRALGFNTLLDDELHSPIITAFYSPEDPQYRFSEFYRRLKEQGFVIYPGK
VSQSDCFRIGNIGEVYAADITALLTAIRTA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1m32A01
TSRNYLLLTPGPLTTGGVAARHQRYQQNQRSLVAGXRALGFNTLLDDELHSPIITAFYSPEDPQYRFSEFYRRLKEQGFV
IYPGKVSQSDCFRIGNIGEVYAADITALLTAIRTA
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:37

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:37

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:12

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"