CATH Domain: 1m2tA02 XML data for domain: 1m2tA02

Molscript image for 1m2tA02
1m2tA02
PDB coordinates for domain 1m2tA02

PDB 1m2t, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
4 Few Secondary Structures
4.10 Irregular
4.10.470 Ricin (A Subunit), domain 2
4.10.470.10 Ricin (A Subunit), domain 2 Gene3D
4.10.470.10.8
4.10.470.10.8.1
4.10.470.10.8.1.1
4.10.470.10.8.1.1.1
4.10.470.10.8.1.1.1.1

[top]
Segment boundaries for domain 1m2tA02

Chopping figure for domain 1m2tA02
DomainStart PDB ResidueStop PDB Residue
1m2tA01 1 167
1m2tA02 168 248

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 4.10.470.10.8.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1abrA02 92.53 RRNA N-glycosylase activityAbrus precatoriusAbrin-aGalactose bindingNegative regulation of translation 4.10.470.10 85 37 95 1.39 1.46
1hwmA02 90.49 Sambucus ebulusRibosome-inactivating protein 4.10.470.10 86 28 94 1.42 1.51
3brcA01 69.08 Methanothermobacter thermautotrophicus str. Delta HConserved protein 1.10.287.470 34 8 41 1.90 4.53
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1m2tA02
RFNPILWRARQYINSGASFLPDVYMLELETSWGQQSTQVQHSTDGVFNNPIALAIAPGVIVTLTNIRDVIASLAIMLFVC
G
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1m2tA02
RFNPILWRARQYINSGASFLPDVYMLELETSWGQQSTQVQHSTDGVFNNPIALAIAPGVIVTLTNIRDVIASLAIMLFVC
GERPSSS
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:38

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:38

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:12

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"