Set cath from cathlist by auto on 05 Mar 2006 18:18
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1m1nB01 | 70 | 215 |
| 1m1nB02 | 216 | 320 |
| 1m1nB03 | 365 | 470 |
| 1m1nB04 | 321 | 364 |
| 1m1nB04 | 485 | 523 |
There are 2 matching structural neighberhood comparisons for CATH ID 1.20.89.10.1.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
2zinA01 | 75.67 | 1.10.287.540 | 48 | 10 | 53 | 2.35 | 4.43 | |
![]() |
2hepA00 | 72.36 | 1.10.287.540 | 42 | 7 | 40 | 1.68 | 4.10 |
>pdb|1m1nB04 GLDWTDEFLMKVSEISGQPIPASLTKERGRLVDMMTDSHTWLHGLGYEGAMQILTTLVNSILERLDEETRGMQATDYNHD LVR
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"