Set cath from cathlist by auto on 05 Mar 2006 19:22
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1m1nB01 | 70 | 215 |
| 1m1nB02 | 216 | 320 |
| 1m1nB03 | 365 | 470 |
| 1m1nB04 | 321 | 364 |
| 1m1nB04 | 485 | 523 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1m1nB01 CQPLGAVLCALGFEKTMPYVHGSQGCVAYFRSYFNRHFREPVSCVSDSMTEDAAVFGGQQNMKDGLQNCKATYKPDMIAV STTCMAEVIGDDLNAFINNSKKEGFIPDEFPVPFAHTPSFVGSHVTGWDNMFEGIARYFTLKSMDD
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"