Set cath from cathlist by auto on 05 Mar 2006 19:21
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1m1nA01 | 4 | 62 |
| 1m1nA01 | 345 | 479 |
| 1m1nA02 | 63 | 205 |
| 1m1nA03 | 206 | 320 |
There are 16 matching structural neighberhood comparisons for CATH ID 3.40.50.1980.3.1.1.1.1 (SIMAX score < 5)
>pdb|1m1nA03 VLGKRDEDTTFASTPYDVAIIGDYNIGGDAWSSRILLEEMGLRCVAQWSGDGSISEIELTPKVKLNLVHCYRSMNYISRH MEEKYGIPWMEYNFFGPTKTIESLRAIAAKFDESI
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"