Set cath from cathlist by auto on 05 Mar 2006 19:21
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1m1nA01 | 4 | 62 |
| 1m1nA01 | 345 | 479 |
| 1m1nA02 | 63 | 205 |
| 1m1nA03 | 206 | 320 |
There are 2 matching structural neighberhood comparisons for CATH ID 3.40.50.1980.17.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1mioA01 | 86.59 | 3.40.50.1980 | 239 | 37 | 78 | 1.44 | 1.84 | |
![]() |
1mioB04 | 73.38 | 3.40.50.1980 | 98 | 15 | 48 | 1.77 | 3.65 |
>pdb|1m1nA01 MSREEVESLIQEVLEVYPEKARKDRNKHLAVNDPAVTQSKKCIISNKKSQPGLMTIRGCRLEGKRVMLYIGGLRPRHVIG AYEDLGMEVVGTGYEFAHNDDYDRTMKEMGDSTLLYDDVTGYEFEEFVKRIKPDLIGSGIKEKFIFQKMGIPFREMHSWD YSGPYHGFDGFAIFARDMDMTLNNPCWKKLQAPW
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"