Set cath from cathlist by auto on 05 Mar 2006 18:04
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1m15A01 | 2 | 95 |
| 1m15A02 | 98 | 357 |
There are 2 matching structural neighberhood comparisons for CATH ID 1.10.135.10.1.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1qh4A01 | 90.94 | 1.10.135.10 | 97 | 37 | 93 | 2.37 | 2.53 | |
![]() |
3l2fR01 | 88.40 | 1.10.135.10 | 102 | 27 | 88 | 2.95 | 3.34 |
>pdb|1m15A01 VDQATLDKLEAGFKKLQEASDCKSLLKKHLTKDVFDSIKNKKTGMGATLLDVIQSGVENLDSGVGIYAPDAESYRTFGPL FDPIIDDYHGGFKL
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"