Set cath from cathlist by auto on 05 Mar 2006 19:06
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1m0wA01 | 7 | 51 |
| 1m0wA01 | 160 | 188 |
| 1m0wA01 | 427 | 437 |
| 1m0wA02 | 52 | 63 |
| 1m0wA02 | 118 | 159 |
| 1m0wA02 | 438 | 491 |
| 1m0wA03 | 64 | 115 |
| 1m0wA03 | 323 | 355 |
| 1m0wA04 | 189 | 322 |
| 1m0wA05 | 356 | 417 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1m0wA02 PIPRKCFDEAVQKKQNFRLGIFRSDYLIDKKKGTEQIKQVEFNTVSVSFAGLSEPIISELGIYGCVLFNDEQVLSNEFSG SLLRSKFNTSNEGGVAAGFGCLDSIILY
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"