CATH Domain: 1m0uA02 XML data for domain: 1m0uA02

Molscript image for 1m0uA02
1m0uA02
PDB coordinates for domain 1m0uA02

PDB 1m0u, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1050 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2
1.20.1050.10 Gene3D
1.20.1050.10.9
1.20.1050.10.9.1
1.20.1050.10.9.1.1
1.20.1050.10.9.1.1.1
1.20.1050.10.9.1.1.1.1

[top]
Segment boundaries for domain 1m0uA02

Chopping figure for domain 1m0uA02
DomainStart PDB ResidueStop PDB Residue
1m0uA01 47 121
1m0uA01 234 249
1m0uA02 122 233

Structural Neighbourhood (20 entries)

There are 20 matching structural neighberhood comparisons for CATH ID 1.20.1050.10.9.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 20 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3h1nA02 88.35 Bordetella bronchisepticaProbable glutathione S-transferase 1.20.1050.10 115 16 91 2.27 2.49
3fr3B02 87.91 Glutathione S-transferase [EC:2.5.1.18]Metabolism of xenobiotics by cytochrome P450Glutathione S-transferaseGlutathione metabolismPlasmodium falciparum 1.20.1050.10 114 16 86 1.98 2.28
2gsqA02 87.86 Ommastrephes sloaniGlutathione S-transferase 1.20.1050.10 108 18 93 2.00 2.13
1dugA02 87.74 Fibrinogen gamma chainGlutathione S-transferase class-mu 26 kDa isozymeExternal side of plasma membraneFibrinogen complexEukaryotic cell surface binding 1.20.1050.10 105 20 92 2.27 2.44
2dsaA02 85.88 Glutathione S-transferase [EC:2.5.1.18]Metabolism of xenobiotics by cytochrome P450Glutathione S-transferaseGlutathione metabolismBurkholderia xenovorans LB400 1.20.1050.10 106 14 91 2.13 2.32
1n2aA02 84.60 Metabolism of xenobiotics by cytochrome P450Glutathione metabolismGlutathione S-transferase [EC:2.5.1.18]Glutathione S-transferaseEscherichia coli K-12 1.20.1050.10 106 10 91 2.49 2.71
1eemA02 83.72 Glutathione S-transferase [EC:2.5.1.18]Drug metabolism - cytochrome P450Glutathione S-transferase omega-1Metabolism of xenobiotics by cytochrome P450Homo sapiens 1.20.1050.10 115 9 91 2.79 3.06
1hqoA02 83.26 Soluble fractionCytosolProtein URE2Cytoplasmic sequestering of transcription factorProtein urmylation 1.20.1050.10 126 11 86 2.48 2.87
1oe8A02 83.03 Schistosoma haematobiumGlutathione S-transferase class-mu 28 kDa isozyme 1.20.1050.10 124 16 87 2.94 3.34
1v2aA02 82.85 Anopheles dirusGlutathione transferase gst1-6 1.20.1050.10 132 22 79 2.69 3.38
3f6dB02 82.79 Anopheles dirusGlutathione transferase GST1-4 1.20.1050.10 123 11 81 2.47 3.04
1gwcA02 82.24 Aegilops tauschiiGlutathione S-transferase 1 1.20.1050.10 141 15 75 2.39 3.15
1gnwA02 81.97 Glutathione bindingMicrosomeChloroplast stromaPlasma membraneToxin catabolic process 1.20.1050.10 125 12 85 3.99 4.66
1aw9A02 81.87 Glutathione transferase III(A)Zea mays 1.20.1050.10 121 13 87 3.74 4.27
1nhyA02 81.39 Positive regulation of transcription from RNA polymerase II promoterCalcium ion bindingNucleusElongation factor 1-gamma 1Transcription coactivator activity 1.20.1050.10 139 17 78 3.26 4.16
1k0oB02 80.41 Membrane fractionChloride intracellular channel protein 1Soluble fractionChloride transportSignal transduction 1.20.1050.10 123 10 75 2.72 3.60
2vo4A02 80.01 2,4-D inducible glutathione S-transferaseGlycine max 1.20.1050.10 132 8 75 2.53 3.34
2pvqA02 79.96 Glutathione S-transferaseOchrobactrum anthropi 1.20.1050.10 104 17 89 3.00 3.36
3cbuA02 79.59 Glutathione S-transferase [EC:2.5.1.18]Ralstonia eutropha JMP134Metabolism of xenobiotics by cytochrome P450Probable gst-related proteinGlutathione metabolism 1.20.1050.10 132 13 78 3.40 4.36
2c3nA02 76.39 Soluble fractionGlutathione S-transferase theta-1Glutathione metabolic processGlutathione transferase activityGlutathione metabolism 1.20.1050.10 160 13 68 3.01 4.38
[1]
Displaying entries 1 to 20 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1m0uA02
GLCGATPWEDLQIDIVVDTINDFRLKIAVVSYEPEDEIKEKKLVTLNAEVIPFYLEKLEQTVKDNDGHLALGKLTWADVY
FAGITDYMNYMVKRDLLEPYPALRGVVDAVNA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1m0uA02
GLCGATPWEDLQIDIVVDTINDFRLKIAVVSYEPEDEIKEKKLVTLNAEVIPFYLEKLEQTVKDNDGHLALGKLTWADVY
FAGITDYMNYMVKRDLLEPYPALRGVVDAVNA
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:20

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:20

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:11

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"