Resources »

CATH Domain: 1ltmA02

Molscript image for 1ltmA02

1ltmA02

PDB coordinates for domain 1ltmA02

PDB 1ltm, Chain A, Domain 2

CATH Code	Level Description	Links
1	Mainly Alpha
1.10	Orthogonal Bundle
1.10.530	Lysozyme
1.10.530.10		Gene3D
1.10.530.10.5
1.10.530.10.5.1
1.10.530.10.5.1.1
1.10.530.10.5.1.1.1
1.10.530.10.5.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 1ltmA02

Chopping figure for domain 1ltmA02

Domain	Start PDB Residue	Stop PDB Residue
1ltmA01	51	97
1ltmA01	171	235
1ltmA02	109	167
1ltmA02	248	361

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.

[top]
Domain ATOM Sequence

>pdb|1ltmA02
GPNGAWLRYRKKFITPDNVQNGVVFWNQYEDALNRAWQVYGVPPEIIVGIIGVETRWGRDPVDAIGSVANYFKAHGWVKG
DQVAVMANGQAPGLPNGFKTKYSISQLAAAGLTPQQPLGNHQQASLLRLDVGTGYQYWYGLPNFYTITRYNHSTHYAMAV
WQLGQAVALARVQ

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|1ltmA02
GPNGAWLRYRKKFITPDNVQNGVVFWNQYEDALNRAWQVYGVPPEIIVGIIGVETRWGRDPVDAIGSVANYFKAHGWVKG
DQVAVMANGQAPGLPNGFKTKYSISQLAAAGLTPQQPLGNHQQASLLRLDVGTGYQYWYGLPNFYTITRYNHSTHYAMAV
WQLGQAVALARVQ

BLAST against CATH

[top]
Domain History Events (134)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1ltm002" to "1ltmA02" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Domain assigned by lewis on 19 Jan 2007 16:21

Assigning domain 1ltm002 to 1.10.530.10 (as agreed with the CATH update team) after the chain has been rechopped. The reason is that the domain is very similar to an old domain (from the previous chopping) which was in 1.10.530.10 at the time the chain was unchopped.

Update comment by auto on 19 Jan 2007 07:32

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 19 Jan 2007 03:42

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 18 Jan 2007 23:36

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 18 Jan 2007 19:51

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 18 Jan 2007 15:46

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 18 Jan 2007 11:40

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 18 Jan 2007 07:33

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 18 Jan 2007 03:33

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 17 Jan 2007 23:34

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 17 Jan 2007 19:40

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 17 Jan 2007 15:45

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 17 Jan 2007 11:48

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 17 Jan 2007 07:37

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 17 Jan 2007 03:36

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 16 Jan 2007 23:39

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 16 Jan 2007 19:36

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 16 Jan 2007 15:43

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 16 Jan 2007 11:43

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 16 Jan 2007 07:32

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 16 Jan 2007 03:33

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 15 Jan 2007 23:26

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 15 Jan 2007 19:32

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 15 Jan 2007 15:35

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 15 Jan 2007 11:41

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 15 Jan 2007 07:30

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 15 Jan 2007 03:31

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 14 Jan 2007 23:32

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 14 Jan 2007 19:33

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 14 Jan 2007 15:34

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 14 Jan 2007 11:38

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 14 Jan 2007 07:32

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 14 Jan 2007 03:32

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 13 Jan 2007 23:30

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 13 Jan 2007 19:31

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 13 Jan 2007 15:45

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 13 Jan 2007 11:39

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 13 Jan 2007 07:32

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 13 Jan 2007 03:41

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 12 Jan 2007 23:32

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 12 Jan 2007 19:33

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 12 Jan 2007 15:41

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 12 Jan 2007 11:41

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 12 Jan 2007 07:33

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 12 Jan 2007 03:35

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 11 Jan 2007 23:37

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 11 Jan 2007 19:33

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 11 Jan 2007 15:43

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 11 Jan 2007 11:48

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 11 Jan 2007 07:36

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 11 Jan 2007 03:35

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 10 Jan 2007 23:39

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 10 Jan 2007 19:35

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 10 Jan 2007 15:43

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 10 Jan 2007 11:50

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 10 Jan 2007 07:37

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 10 Jan 2007 03:36

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 09 Jan 2007 23:33

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 09 Jan 2007 19:34

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 09 Jan 2007 15:39

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 09 Jan 2007 11:43

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 09 Jan 2007 07:37

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 09 Jan 2007 03:38

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 08 Jan 2007 23:41

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 08 Jan 2007 20:16

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 08 Jan 2007 15:36

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 08 Jan 2007 11:38

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 08 Jan 2007 07:32

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 08 Jan 2007 03:32

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 07 Jan 2007 23:26

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 07 Jan 2007 19:31

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 07 Jan 2007 15:42

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 07 Jan 2007 11:43

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 07 Jan 2007 07:34

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 07 Jan 2007 03:46

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 06 Jan 2007 23:40

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 30 Dec 2006 15:28

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 30 Dec 2006 11:30

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 30 Dec 2006 07:30

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 30 Dec 2006 03:29

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 29 Dec 2006 23:25

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 29 Dec 2006 19:28

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 29 Dec 2006 15:28

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 29 Dec 2006 11:30

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 29 Dec 2006 07:29

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 29 Dec 2006 03:30

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 28 Dec 2006 23:25

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 28 Dec 2006 19:28

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 28 Dec 2006 15:28

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 28 Dec 2006 11:26

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 28 Dec 2006 07:29

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 28 Dec 2006 03:32

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 27 Dec 2006 23:24

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 27 Dec 2006 19:28

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 27 Dec 2006 15:29

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 27 Dec 2006 11:30

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 27 Dec 2006 07:30

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 27 Dec 2006 03:31

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 26 Dec 2006 23:25

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 26 Dec 2006 19:31

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 26 Dec 2006 15:29

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 26 Dec 2006 11:27

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 26 Dec 2006 07:33

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 26 Dec 2006 03:32

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 25 Dec 2006 23:27

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 25 Dec 2006 19:31

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 25 Dec 2006 15:29

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 25 Dec 2006 11:30

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 25 Dec 2006 07:31

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 25 Dec 2006 03:31

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 24 Dec 2006 23:33

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 24 Dec 2006 19:30

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 24 Dec 2006 15:32

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 24 Dec 2006 11:27

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 24 Dec 2006 07:30

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 24 Dec 2006 03:30

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 23 Dec 2006 23:34

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 23 Dec 2006 19:29

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 23 Dec 2006 15:29

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 23 Dec 2006 11:29

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 23 Dec 2006 07:30

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 23 Dec 2006 03:34

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 22 Dec 2006 23:31

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 22 Dec 2006 19:34

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 22 Dec 2006 15:43

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 22 Dec 2006 11:41

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 22 Dec 2006 07:36

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Update comment by auto on 22 Dec 2006 03:40

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Flow stage update by auto on 22 Dec 2006 03:40

Domain "1ltm002" hits Domain "1d0mA02" (100% over 100%) which is currently in process

Flow stage update by auto on 22 Dec 2006 03:40

NW result present for Domain "1ltm002"

Flow stage update by auto on 20 Dec 2006 19:31

All required files are present for Domain "1ltm002"

Flow stage update by auto on 19 Dec 2006 15:28

Beginning processing for Domain "1ltm002"

Insertion by cuff on 19 Dec 2006 13:58

small selection of more challenging choppings

University College London - Gower Street - London - WC1E 6BT - Telephone: +44 (0)20 7679 2000 - Copyright © 1999-2008 UCL