Set cath from cathlist by auto on 05 Mar 2006 18:51
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1ltdA01 | 10 | 104 |
| 1ltdA02 | 112 | 493 |
There are 1 matching structural neighberhood comparisons for CATH ID 3.10.120.10.6.1.1.1.3 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1j03A00 | 79.91 | 3.10.120.10 | 102 | 15 | 74 | 3.53 | 4.74 |
>pdb|1ltdA01 KISPAEVAKHNKPDDCWVVINGYVYDLTRFLPNHPGGQDVIKFNAGKDVTAIFEPLHAPNVIDKYIAPEKKLGPLQGSMP PELVCPPYAPGETKE
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"