CATH Domain: 1lqlA02 XML data for domain: 1lqlA02

Molscript image for 1lqlA02
1lqlA02
PDB coordinates for domain 1lqlA02

PDB 1lql, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.300 GMP Synthetase; Chain A, domain 3
3.30.300.20 Gene3D
3.30.300.20.11
3.30.300.20.11.1
3.30.300.20.11.1.1
3.30.300.20.11.1.1.1
3.30.300.20.11.1.1.1.1

[top]
Segment boundaries for domain 1lqlA02

Chopping figure for domain 1lqlA02
DomainStart PDB ResidueStop PDB Residue
1lqlA01 4 29
1lqlA02 39 141

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 3.30.300.20.11.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2d7vB00 80.97 Vibrio choleraePutative uncharacterized protein 3.30.300.20 151 10 61 1.96 3.18
2oplB01 78.94 Geobacter sulfurreducensPutative uncharacterized protein 3.30.300.20 154 17 53 1.73 3.21
2pn2A00 78.53 Psychrobacter arcticus 273-4Putative uncharacterized protein 3.30.300.20 129 15 66 2.43 3.65
3h90A02 78.22 Ferrous-iron efflux pump FieFCellular cadmium ion homeostasisCellular zinc ion homeostasisCadmium ion transportEscherichia coli K-12 3.30.70.1350 84 7 74 3.25 4.35
1ib8A01 77.67 Hypothetical proteinRibosome maturation factor rimPStreptococcus pneumoniae 3.30.300.70 83 7 75 3.34 4.41
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1lqlA02
FGPLAALLSGLAACELATANLMAPAKMITINKLLMNVTGSRSTNPTDGYFGLREINLHWEIHSPNSETEIKEFIDFVSKR
CPAHNTLQGVSQLKINVNVTLVH
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1lqlA02
FGPLAALLSGLAACELATANLMAPAKMITINKLLMNVTGSRSTNPTDGYFGLREINLHWEIHSPNSETEIKEFIDFVSKR
CPAHNTLQGVSQLKINVNVTLVH
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:03

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:03

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:10

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"