Set cath from cathlist by auto on 05 Mar 2006 18:07
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
There are 10 matching structural neighberhood comparisons for CATH ID 1.10.260.40.3.1.2.1.2 (SIMAX score < 5)
>pdb|1lmb400 STKKKPLTQEQLEDARRLKAIYEKKKNELGLSQESVADKMGMGQSGVGALFNGINALNAYNAALLAKILKVSVEEFSPSI AREIYEMYEAVS
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"