CATH Domain: 1llnA02 XML data for domain: 1llnA02

Molscript image for 1llnA02
1llnA02
PDB coordinates for domain 1llnA02

PDB 1lln, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
4 Few Secondary Structures
4.10 Irregular
4.10.470 Ricin (A Subunit), domain 2
4.10.470.10 Ricin (A Subunit), domain 2 Gene3D
4.10.470.10.6
4.10.470.10.6.1
4.10.470.10.6.1.1
4.10.470.10.6.1.1.1
4.10.470.10.6.1.1.1.1

[top]
Segment boundaries for domain 1llnA02

Chopping figure for domain 1llnA02
DomainStart PDB ResidueStop PDB Residue
1llnA01 1 175
1llnA02 176 262

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 4.10.470.10.6.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1abrA02 82.91 RRNA N-glycosylase activityAbrus precatoriusAbrin-aGalactose bindingNegative regulation of translation 4.10.470.10 85 24 91 3.05 3.32
1m2tA02 82.79 Beta-galactoside-specific lectin 1Viscum album 4.10.470.10 81 13 90 2.82 3.13
1hwmA02 82.00 Sambucus ebulusRibosome-inactivating protein 4.10.470.10 86 18 91 2.86 3.11
1rl0A02 80.79 Dianthus caryophyllusAntiviral protein DAP-30 4.10.470.10 74 17 85 3.03 3.56
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1llnA02
FYIENVAKFDDANGYQPDPAISLEKNWDSVSVIAKVGTSGDSTVTLPGDLDENNKPWTTATMNDLKNDIMALLTHVTCKV
K
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1llnA02
FXYIENXVXAKFDDANGYQPDPXAISLEKNWDSVSXVIAKVGTSGDSTVTLPGDLXDENNKPWTTATMNDLKNDIMALLT
HVTCKVK
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:38

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:38

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:09

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"