CATH Domain: 1lkoA01 XML data for domain: 1lkoA01

Molscript image for 1lkoA01
1lkoA01
PDB coordinates for domain 1lkoA01

PDB 1lko, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1260 Ferritin;
1.20.1260.10 Gene3D
1.20.1260.10.11
1.20.1260.10.11.1
1.20.1260.10.11.1.1
1.20.1260.10.11.1.1.1
1.20.1260.10.11.1.1.1.1

[top]
Segment boundaries for domain 1lkoA01

Chopping figure for domain 1lkoA01
DomainStart PDB ResidueStop PDB Residue
1lkoA01 2 146
1lkoA02 147 191

Structural Neighbourhood (14 entries)

There are 14 matching structural neighberhood comparisons for CATH ID 1.20.1260.10.11.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 14 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1vjxA00 89.08 Thermotoga maritimaPutative uncharacterized protein 1.20.1260.10 145 17 89 4.14 4.62
1nfvA00 89.06 BacterioferritinBacterioferritinDesulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774 1.20.1260.10 169 17 84 2.58 3.05
2qqyA00 88.17 Bacillus anthracisBacterioferritinPutative uncharacterized protein 1.20.1260.10 133 15 91 3.29 3.61
2ib0A01 87.62 Mycobacterium tuberculosisCONSERVED HYPOTHETICAL ALANINE RICH PROTEIN 1.20.1260.10 135 10 90 3.43 3.80
2fjcB00 87.61 Treponema pallidumStarvation-inducible DNA-binding proteinAntigen TpF1 1.20.1260.10 156 7 89 3.18 3.57
3kwoA00 86.96 DNA protection during starvation proteinCampylobacter jejuniStarvation-inducible DNA-binding proteinProtein binding 1.20.1260.10 144 9 91 3.58 3.90
1vlgA00 86.19 Porphyrin and chlorophyll metabolismThermotoga maritimaFerritin [EC:1.16.3.1]Ferritin 1.20.1260.10 164 11 86 3.03 3.50
2qf9A01 83.81 Putative secreted proteinStreptomyces coelicolor 1.20.1260.10 140 6 84 3.34 3.94
2yw6B00 83.09 Mycobacterium smegmatisDNA protection during starvation proteinStarvation-inducible DNA-binding protein 1.20.1260.10 150 7 89 4.17 4.67
1jkvA01 82.28 Lactobacillus plantarumManganese catalase 1.20.1260.10 197 12 69 2.48 3.57
2oh3A01 81.24 Magnetospirillum magneticum AMB-1Uncharacterized conserved protein 1.20.1260.10 132 13 84 3.50 4.13
2i0mA02 79.01 Phosphate transport system proteinPhosphate transport system protein phoUStreptococcus pneumoniae 1.20.58.220 101 3 61 2.68 4.37
2rklB00 72.55 Multivesicular bodyVacuolar protein sorting-associated protein VTA1Membrane fractionProtein bindingEndocytosis 1.20.5.420 50 8 34 1.28 3.71
1skvA00 72.39 Protein D-63Sulfolobus virus 1 1.10.287.660 62 6 35 1.41 4.01
[1]
Displaying entries 1 to 14 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1lkoA01
KSLKGSRTEKNILTAFAGESQARNRYNYFGGQAKKDGFVQISDIFAETADQEREHAKRLFKFLEGGDLEIVAAFPAGIIA
DTHANLIASAAGEHHEYTEMYPSFARIAREEGYEEIARVFASIAVAEEFHEKRFLDFARNIKEGR
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1lkoA01
MKSLKGSRTEKNILTAFAGESQARNRYNYFGGQAKKDGFVQISDIFAETADQEREHAKRLFKFLEGGDLEIVAAFPAGII
ADTHANLIASAAGEHHEYTEMYPSFARIAREEGYEEIARVFASIAVAEEFHEKRFLDFARNIKEGR
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:21

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:21

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:09

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"